KEGG   Candidatus Koribacter versatilis: Acid345_3865Help
Entry
Acid345_3865      CDS       T00352                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
aba  Candidatus Koribacter versatilis
Pathway
aba00010  Glycolysis / Gluconeogenesis
aba00052  Galactose metabolism
aba00500  Starch and sucrose metabolism
aba00520  Amino sugar and nucleotide sugar metabolism
aba00521  Streptomycin biosynthesis
aba01100  Metabolic pathways
aba01110  Biosynthesis of secondary metabolites
aba01120  Microbial metabolism in diverse environments
aba01130  Biosynthesis of antibiotics
aba01200  Carbon metabolism
Module
aba_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:aba00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acid345_3865
   00052 Galactose metabolism
    Acid345_3865
   00500 Starch and sucrose metabolism
    Acid345_3865
   00520 Amino sugar and nucleotide sugar metabolism
    Acid345_3865
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Acid345_3865
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Acid345_3865
Enzymes [BR:aba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Acid345_3865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N
Motif
Other DBs
NCBI-ProteinID: ABF42865
UniProt: Q1IJT5
Position
complement(4576617..4577660)
Genome map
AA seq 347 aa AA seqDB search
MSYAIGVDLGGTNLRIAAVEERGTLLEKVTLGTQVQRGREYVVGQMTDAIRHVTTKYQDH
GKLIGIGIGVPGFIDMDTGTVRESPNLPGWSNYPVHKDIESRLGTKVILENDANAAAMGE
KWLGAGRDTDDMVMYTLGTGVGGGIIMAGRLWHGMNGMAGELGHHTVLPDGHICGCGNHG
CLEQYASATAVVRMAREAVANGLSDALANASRNDVEFSSKVIYQLAIQGDKAAQEIFNTV
GHSIGIAVANMVNALNFPMYVIGGGVASAWDAFHNPMMEEVRKRSFIYRVTAPEAVAAGQ
KRTIVTRALLGGDAGLFGAARLPMVVNGESSAPAAQSKADTPVAGTR
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgtcttacgcaatcggtgtggacctcggcggtaccaatctgcgaatcgcagccgtcgaa
gaacgcggcaccctcctcgaaaaagtcacgcttggcacgcaggtacagcgcggccgcgaa
tatgttgtcggtcaaatgaccgatgccatccgccacgtcactaccaagtaccaggaccac
ggcaagctgattggcatcggcatcggtgtcccgggcttcattgatatggataccggcacc
gtgcgggaatcgccgaacctacccggctggtcgaactatcccgtgcataaggacatcgag
agccggctcggaaccaaggtcattcttgagaacgacgccaacgccgccgcgatgggcgag
aagtggctcggcgccggccgcgacaccgacgacatggtgatgtacacgctcggcaccggc
gtaggtggtggaattatcatggccggccgcttgtggcacgggatgaacggcatggccggg
gagcttggccaccataccgttttgcccgacggccatatctgcggctgcggcaaccacggc
tgcctcgaacaatatgcctcggcgacggccgtcgtgcgcatggcgcgcgaagctgtcgcc
aacggcctgtccgacgcgctcgccaatgcctcacgcaacgacgtagagttcagttcgaag
gtgatttaccagctcgccatccagggtgacaaggccgcgcaggagattttcaacaccgtc
ggccactcgatcggcatcgccgtggccaacatggtcaacgcgctgaatttcccgatgtac
gtgatcggcggcggcgttgccagcgcctgggacgccttccacaatccgatgatggaagaa
gtacgcaagagatcgttcatctatcgcgtcaccgcgccggaagcggtcgctgccggccag
aaacgcaccatcgtgacccgcgctttgctcggcggcgatgccggtctgttcggcgccgcc
cgcctgccgatggtcgtcaacggcgagtcgtccgcacccgccgcgcaatccaaggctgat
acaccggtagccggcactcgctaa

DBGET integrated database retrieval system