KEGG   Candidatus Koribacter versatilis: Acid345_4706Help
Entry
Acid345_4706      CDS       T00352                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
aba  Candidatus Koribacter versatilis
Pathway
aba00630  Glyoxylate and dicarboxylate metabolism
aba01100  Metabolic pathways
aba01110  Biosynthesis of secondary metabolites
aba01120  Microbial metabolism in diverse environments
aba01200  Carbon metabolism
Module
aba_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:aba00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Acid345_4706
Enzymes [BR:aba01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Acid345_4706
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ABF43706
UniProt: Q1IHE4
Position
complement(5565131..5566447)
Genome map
AA seq 438 aa AA seqDB search
MATENPTAQLRLDWETNPRWKGITRPYTAEDVARLRGTIRIDHTLARLGAERLWKLLQED
KYTQALGALTGNQAVQMVKAGLKAIYVSGWQVAGDANDAGQMYPDQSLYPADSVPNLVRR
LNNALLRADQIHHSEGKNGMYFLAPMIADAEAGFGGNLNAFELMKAMIESGAACVHFEDQ
LSSAKKCGHLGGKVLVPTGEAIQKLVAARLAADICGVPTLILARTDANSAHLLTSDIDPY
DREFCTGERTSEGFFCIRGGLDSAIARGLAYAPYADLIWCETSEPNIGEAQRFAEAIHAK
FPGKMLAYNCSPSFNWKKKLSEEDIARFQPALAEMGYKFQFITLAGFHALNLSMYELATG
YRQSGMTAYSALQQREFQLEPEGYEAAKHQRFVGTGYFDQVQNVVTSGKASTRALEHSTE
AEQFHASETPEKSGVAAD
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggcaacggagaacccgactgcccagcttcgccttgactgggagaccaacccacgctgg
aagggcatcacccggccttacaccgcagaagacgttgcgcgattgcgcggcaccattcgc
attgaccacacgctggcgcgcctcggcgcagagcggctgtggaagctgcttcaagaagac
aaatacacccaggcgctcggtgcattgaccggcaaccaggcggtgcagatggtcaaagcc
ggattgaaagcgatctacgtctcgggctggcaagtggcgggcgacgccaatgacgcgggc
caaatgtatcccgaccaaagcttgtatccggcagatagcgttccgaaccttgtgcgccga
ttgaacaacgcactgttgcgcgccgatcagatccatcactccgaggggaagaatggaatg
tatttcctcgcgccgatgatcgccgatgccgaagccggcttcggcggcaacctcaacgcc
ttcgagttgatgaaagcgatgatcgagtcgggagcagcctgcgttcacttcgaggaccaa
ctgtcttcggcgaagaagtgcgggcacctcggcggcaaagttctggtaccgaccggcgaa
gcgatccagaagctggtcgcagctcgcttggcagccgacatctgcggcgtgccgacgctg
atcctggcgcgtaccgatgcgaacagcgcccatctgctcaccagcgacatcgatccctac
gatcgcgagttctgcaccggcgagcgcaccagcgaaggcttcttctgcattcgcggcggg
ttggattccgccatcgcgcgcggcttggcctacgcaccgtatgcggacctgatctggtgc
gaaacttcggaacccaacatcggcgaggcgcagcgcttcgcggaggcgatccatgcgaag
tttccgggaaagatgcttgcttacaactgctctccgtcgttcaactggaagaagaaattg
tcggaggaagacatcgcgcgcttccagccggcgctcgcggaaatgggttacaagttccag
ttcattaccctggcggggttccatgcgctgaacctcagcatgtacgagttggccacgggt
tatcgtcagagcggcatgacggcctattccgccctgcagcagcgggaattccaactggag
cccgagggttacgaagcggcgaaacaccagcgcttcgtaggcaccggctacttcgaccag
gtgcagaacgtggtcaccagcggcaaggcctcgacccgggccctcgaacactccacggaa
gccgaacagttccacgctagcgaaacgcccgaaaagagcggcgtggcggccgactag

DBGET integrated database retrieval system