KEGG   Acinetobacter baumannii AB031: IX88_03310Help
Entry
IX88_03310        CDS       T03376                                 

Definition
(GenBank) aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
abaa  Acinetobacter baumannii AB031
Pathway
abaa00051  Fructose and mannose metabolism
abaa01100  Metabolic pathways
abaa01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:abaa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    IX88_03310
Enzymes [BR:abaa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     IX88_03310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AIL74236
UniProt: A0A334G9X1
Position
complement(685644..686420)
Genome map
AA seq 258 aa AA seqDB search
MKTASVNKHDLMQHAQQDMQKWMSDLDLTDRQKLALTCRILFDHGHDAGLAGQITCRSEN
KETFITQRFGLGFDEINASNLLEVNQDLEPINQEGMANPANRFHTWIYKEHPEVNCIIHT
HPTYVAALSMLQIPLMISQMDVCALYEDCSFVGHWPGVPVGNEEGLLISSALGKNRAVLL
SHHGQLVTGKTIEEACNLALLIERAAQLQLLAMSAGQIQPIPHALAAEAHDWVSTDKRNK
VNFAYYARKALKKHSDCI
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaagactgcttctgtaaacaaacacgacttgatgcaacacgcacagcaagacatgcaa
aagtggatgagcgacttagatttaacagaccgtcaaaagcttgcactgacttgccgtatt
ttatttgatcatgggcatgacgctggtttagcgggtcaaattacatgccgtagtgaaaat
aaagaaacctttattactcaacgtttcggtttaggttttgatgaaattaatgcttcaaac
ttgcttgaggtgaatcaggacttagaacccatcaatcaagaaggaatggcaaatccagcc
aaccgttttcacacatggatttataaagaacacccagaagtgaactgtattatccatacg
catccaacgtatgtagcggccctgtcgatgctacagattccacttatgatttcccaaatg
gacgtctgcgcactttacgaagactgctcatttgtaggccactggccgggagttcctgta
ggtaatgaagaaggtcttttgatttcttccgcgctgggtaaaaaccgcgctgttttgttg
tctcatcatggtcaattggtcacaggaaaaaccattgaagaagcctgcaacttggcgctt
ttaattgaacgcgcagctcaactgcaacttttagccatgtctgccggacaaatccaacct
atcccccacgctttggcagcggaagcccatgattgggtgtctaccgataaacgcaacaaa
gtgaactttgcttactacgcacgtaaagctttgaaaaaacattctgactgtatttaa

DBGET integrated database retrieval system