KEGG   Acinetobacter baumannii AB031: IX88_06880Help
Entry
IX88_06880        CDS       T03376                                 

Definition
(GenBank) nuclease PIN
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
abaa  Acinetobacter baumannii AB031
Brite
KEGG Orthology (KO) [BR:abaa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    IX88_06880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AIL74910
UniProt: A0A059ZH94
Position
1437623..1439254
Genome map
AA seq 543 aa AA seqDB search
MNSNLPPVSDSKLAANLQAKSTNVHVPTPKFFMPVFLTIIIATLIYIGFQVSADLAHVPP
LSLYSVILLSTALLIALGFEFVNGFHDTANAVATVIYTNALPAPVAVMWAGFCNFLGVMV
ASGAVAYGIIALLPVELIMNMGSGAGFAMVFALLIAAILWNLGTWFLGIPASSSHTLIGS
ILGVGIMNHLLSASTGVTTSGVDMDQVIKVGKALLFSPLIGFAFAAIVFLLVKTIFKRQL
ELFQPPEGNKPPPAIIRAILIFTCTGVSFAHGSNDGQKGMGLIMLILVGLVPLAYSLNKN
LDTQQVQSFHQLSSQTAVLLNQNQPELTDEKARAVLTKYIQTKQQTPEVVPALASMTDHL
GERVSSYSNLKDIPEAAISEIRNDMYLSTTTFKRLDKADALPKMDDSQKKLVKDYRSSLD
SFLQYIPNWVKVAVALALGLGTMVGWKRIVVTVGERIGKHHMTYGQGMSAELVAMSTIAA
ADGLGMPVSTTHVLNSAVAGTMVANKSGLNFNTVKTILSAWVFTLPATICLSGGLYWLFL
QFV
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgaattctaatctaccccctgtttcggattcaaaacttgcggcaaacctgcaagcaaaa
tcgacgaatgtacatgtcccgacacctaagttttttatgccggtgtttctgacgattatt
attgcaacacttatttatattgggtttcaggtcagtgctgatttagcgcatgttccacct
ttaagcctttattcagttattcttttatctactgcactcttgattgcactaggctttgaa
tttgtaaacggtttccacgacactgctaatgcagttgcaacggttatttatacaaatgct
ttgcctgcaccggttgcagtcatgtgggcaggtttttgtaatttccttggggtaatggtc
gcaagtggtgctgttgcgtatggcattattgcattgcttccagttgaacttattatgaac
atgggcagtggtgctggctttgcaatggtttttgcattgttgatcgctgcaattctttgg
aatcttggtacttggttcttgggaattcctgcttctagctctcataccttgattggttca
atcttaggtgtgggtattatgaatcatctgttgagtgcatcgactggcgtaacgaccagt
ggtgttgatatggatcaggtgattaaagtaggtaaggcattattattttctcctttaatt
ggttttgcttttgcggcaattgtattcttgttggttaaaactattttcaaacgccaatta
gaattattccagccacctgaagggaataagccaccaccagcaatcattcgtgcaattctt
atctttacctgtacaggtgtgagttttgcacatggttctaatgatggccaaaaaggtatg
ggtcttatcatgcttattttggttggtttagtgccattagcttattcattaaataaaaac
ctcgatacacagcaggttcaatcattccaccagctttcttctcaaactgcggttttgtta
aaccaaaatcaaccagaattgactgacgaaaaagcgcgtgcggttttaactaaatacatt
caaaccaagcaacaaacgcctgaagttgtgcctgcattggcaagcatgactgaccatttg
ggtgagcgtgtttctagctatagcaacttaaaagatattccagaagctgcaattagcgaa
atccgtaatgacatgtatttgagcacaacgacgtttaagcgtttggataaggcagatgct
ttaccaaaaatggatgactcacagaaaaagcttgtgaaagattatcgtagtagcttggat
tcattcttacaatacattccaaactgggtgaaagtggcagtcgcattagcgcttggactt
ggtactatggttggctggaaacgtattgtggtaactgtcggtgagcgtattggtaagcat
cacatgacttatggtcaagggatgtctgctgaacttgtcgcaatgagtacaattgctgca
gcagatggtttaggtatgccggtttcaacaacacacgttttaaacagtgctgttgcaggt
actatggttgccaataaatcaggcctgaatttcaatactgtaaaaacaattctctctgca
tgggtatttacacttcctgcaaccatctgtttgtctggtggtctatactggttgttctta
cagtttgtataa

DBGET integrated database retrieval system