KEGG   Acinetobacter baumannii AB031: IX88_08720Help
Entry
IX88_08720        CDS       T03376                                 

Definition
(GenBank) beta-ketoadipyl CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
abaa  Acinetobacter baumannii AB031
Pathway
abaa00071  Fatty acid degradation
abaa00072  Synthesis and degradation of ketone bodies
abaa00280  Valine, leucine and isoleucine degradation
abaa00310  Lysine degradation
abaa00362  Benzoate degradation
abaa00380  Tryptophan metabolism
abaa00620  Pyruvate metabolism
abaa00630  Glyoxylate and dicarboxylate metabolism
abaa00640  Propanoate metabolism
abaa00650  Butanoate metabolism
abaa00900  Terpenoid backbone biosynthesis
abaa01100  Metabolic pathways
abaa01110  Biosynthesis of secondary metabolites
abaa01120  Microbial metabolism in diverse environments
abaa01130  Biosynthesis of antibiotics
abaa01200  Carbon metabolism
abaa01212  Fatty acid metabolism
abaa02020  Two-component system
Brite
KEGG Orthology (KO) [BR:abaa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    IX88_08720
   00630 Glyoxylate and dicarboxylate metabolism
    IX88_08720
   00640 Propanoate metabolism
    IX88_08720
   00650 Butanoate metabolism
    IX88_08720
  09103 Lipid metabolism
   00071 Fatty acid degradation
    IX88_08720
   00072 Synthesis and degradation of ketone bodies
    IX88_08720
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    IX88_08720
   00310 Lysine degradation
    IX88_08720
   00380 Tryptophan metabolism
    IX88_08720
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    IX88_08720
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    IX88_08720
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    IX88_08720
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:abaa04147]
    IX88_08720
Enzymes [BR:abaa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     IX88_08720
Exosome [BR:abaa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   IX88_08720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Dodecin
Motif
Other DBs
NCBI-ProteinID: AIL75255
Position
complement(1843412..1844617)
Genome map
AA seq 401 aa AA seqDB search
MLNAYIYDGLRSPFGRHAGELASIRPDDLAATVIQKLLEKTGVPGADIEDVILGDTNQAG
EDSRNVARNALLLAGLPVTVPGQTVNRLCASGLSAVIDSARAITCGEGELYIAGGVESMS
RAPFVMGKAESAYSRDAKIYDTTIGSRFPNKKIIAQYGGHSMPETGDNVAAEFGISREQA
DLFAAQSQAKYQKAKEEGFFVDEITPIEVFQGKKLPPKLVSEDEHPRPSSTVEALTKLKP
LFEGGVVTAGNASGINDGAAALLIGSEAAGQKYGLKPMAKILSAAAAGIEPRIMGAGPIE
AIKKAVARAGLTLDDMDIIEINEAFASQVLSCLKGLNIDFNDPRVNPNGGAIAVGHPLGA
SGARLALTVARELIRRKKKYAVVSLCIGVGQGLAMVIENVS
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgttaaatgcatatatttatgatggtttacgtagtccatttggccgtcatgcgggtgaa
cttgcctcaattcgtcctgatgatttagccgcaactgtcattcaaaaactactagaaaaa
actggtgtgccgggtgcggatattgaagatgttattttaggcgacaccaaccaagctgga
gaagatagccgtaatgtggcacgaaatgcattattacttgccggtttacctgttactgta
ccgggccagacagtaaaccgtctatgtgcgagtggtttaagcgctgtgattgactcggca
cgtgcgattacttgtggtgaaggtgaattgtatattgcaggtggtgtagaaagtatgtca
cgtgcgcccttcgtgatgggtaaagccgaaagtgcttatagccgtgatgcaaaaatctat
gacaccaccattggctctcgttttccaaataaaaaaattattgcgcagtacggtggtcat
tcaatgcctgaaacgggcgataacgttgcggccgagtttgggattagccgtgaacaagcc
gacttatttgcagcccaatcacaagccaaatatcaaaaagccaaagaagaaggtttcttt
gtcgatgaaattaccccaattgaggttttccaaggcaaaaaattgccccctaaactcgtt
tcagaagatgaacaccctcgcccaagctcaactgttgaagcactcacaaagttaaaacca
ctctttgaaggtggcgtggttacagctggtaatgcctcagggattaatgacggtgcagca
gccctgttgattggttcagaagctgcgggtcaaaaatatggcctaaaaccaatggcaaaa
atcttatcagctgcggctgctggtattgagccacgcattatgggtgcaggtccgatcgaa
gccattaaaaaagctgttgcgcgtgctggccttactttagatgacatggacattatcgaa
attaatgaagcctttgcttcacaggttttatcttgtttaaaaggtttaaatattgatttt
aatgacccacgtgtgaacccgaacggtggtgcaattgcagttggtcatccacttggtgcc
tctggcgcccgtcttgcgttaacagtagcgcgcgagttaattcgccgtaagaagaaatat
gccgtggtgagcctatgtattggtgtaggtcaaggtcttgcaatggtgattgaaaacgtt
tcataa

DBGET integrated database retrieval system