KEGG   Acinetobacter baumannii BJAB0715: BJAB0715_00799Help
Entry
BJAB0715_00799    CDS       T02727                                 

Definition
(GenBank) 7-keto-8-aminopelargonate synthetase-related enzyme
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
abab  Acinetobacter baumannii BJAB0715
Pathway
abab00780  Biotin metabolism
abab01100  Metabolic pathways
Module
abab_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:abab00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BJAB0715_00799
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:abab01007]
    BJAB0715_00799
Enzymes [BR:abab01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     BJAB0715_00799
Amino acid related enzymes [BR:abab01007]
 Aminotransferase (transaminase)
  Class II
   BJAB0715_00799
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DUF3939 Motilin_assoc
Motif
Other DBs
NCBI-ProteinID: AGQ05445
Position
882950..884107
Genome map
AA seq 385 aa AA seqDB search
MSLLDHFATELDELKQQGNFRQFTQNVQHGRFITIQNKTMLNLASNDYLGLAADIDLRQE
FLDCYPLERSYFSSSSSRLLTGNFDEYEQLENSLSQAFGGRAALLFNSGYHMNIGILPAV
ADSKTLILADKLVHASMIDGIRLSGAQYVRYRHNDLQHLEQLLQKYHDDDQIERIIVVTE
SIFSMDGDETDLTALVQLKKRFAKTMLYVDEAHSIGVRGQQGLGCAEQYNVIQEIDFLVG
TLGKALAAVGGYIICHPIIKDYLINKMRPLIFSTAQPPIVMAWANFIFQKVLIAQSQREH
LKNISQYLQQALVQKGYVSPSTSHIIPVIVGESQAAIDKAKQVQESGFYAMPVRPPTVPK
NSSRLRISLTSMVEQHELEALVSFL
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgtcattgctcgatcattttgctacagagttagatgagttaaaacaacaaggtaatttc
agacaatttacccaaaatgtgcagcatggtcgttttattacgattcaaaataaaacgatg
ctcaacttagcttcaaatgactatcttgggttggcagctgatattgatcttcgccaagaa
tttttagattgctatccattagaacgcagctattttagttcttcatcttcacgtttatta
acgggcaattttgatgaatatgaacagttggaaaatagcctaagccaagcatttggtggt
cgggcggctctattattcaatagtggctaccatatgaatattggtattttgcccgctgtt
gctgatagtaaaactttaattctggcagataagttagttcatgccagtatgattgatggg
attcgtttgtctggtgcccagtatgtgcgctatcgacataatgatttgcagcatttagag
caacttctacaaaagtatcatgatgatgaccagattgaacgaatcattgtggtcacggaa
agtatttttagtatggatggcgatgaaacagatttaaccgctttagtccagcttaaaaaa
cgttttgctaaaaccatgttatatgtcgatgaagcgcattcaattggcgtacgtggacag
caaggtttagggtgtgccgaacaatataatgtaattcaggaaattgattttctagttggt
accttgggtaaagcgctagcagcagtcggtggttatattatttgccatccaattattaaa
gattatctcattaataaaatgcgtccgcttatttttagtaccgctcaacctccgattgtt
atggcatgggcaaattttatttttcaaaaagtattaatcgctcaatctcaacgtgaacat
ttaaaaaatattagccaatatcttcaacaagcactggtgcaaaaggggtatgtgagtcca
tcgaccagccatattattccagtgattgtgggagaaagtcaggctgctatcgataaggcg
aaacaggttcaggaaagcggtttttatgccatgcctgtacgtccaccaacagtacctaaa
aatagttcgcgtttgcgcatttccttaacatcaatggttgagcaacatgaacttgaagca
ttggtgagtttcctgtga

DBGET integrated database retrieval system