KEGG   Acinetobacter baumannii BJAB0715: BJAB0715_01283Help
Entry
BJAB0715_01283    CDS       T02727                                 

Definition
(GenBank) hypothetical protein
Organism
abab  Acinetobacter baumannii BJAB0715
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AGQ05929
Position
complement(1352020..1352313)
Genome map
AA seq 97 aa AA seqDB search
MNDSNDRDKNYLITSGFHKVKIISDAQKVFSYGMLTFEAKNQQVYQIKNNQAEKKKGDDL
VFWIENINTGEIVTPKESFNTYTNQTQPIYTPVILNK
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
ttgaatgactcaaacgatcgggataagaattatcttattacttcaggttttcataaagtt
aaaattatttcagacgcccaaaaagtattttcttatggaatgctaacttttgaagcaaaa
aaccaacaggtttatcagattaaaaataatcaagcagagaagaaaaaaggtgatgatctc
gtcttctggatagaaaatataaatacaggtgaaattgttacacctaaagaatcttttaat
acttataccaatcaaacccagccaatctacactcctgtcatacttaataaataa

DBGET integrated database retrieval system