KEGG   Acinetobacter baumannii BJAB0715: BJAB0715_01297Help
Entry
BJAB0715_01297    CDS       T02727                                 

Definition
(GenBank) hypothetical protein
Organism
abab  Acinetobacter baumannii BJAB0715
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OprD
Motif
Other DBs
NCBI-ProteinID: AGQ05943
Structure
PDB: 

Position
complement(1367503..1368723)
Genome map
AA seq 406 aa AA seqDB search
MLSGSVWAGSFIDNSSVELTTRNFYFDRDYQEQSAYPAAKDWTQGFILKANSGYTEGTVG
FGLDVLATAGFKLDADAEHGGTGNLPRDTRTNEPADSYGEIGVTAKAKMSQTELRIGTLM
PMNPVLVASPARLLPQTYRGISLTSKDIKDFDLQAAYLDKVNHRDSTNYEKIKISGVNGR
FKSAETDGLYYLGGNYQFNPALKLTAFYMDVDDLYNQTMVGALHQHKINDTTNFSSQLRY
YRSRDDGQAKAGLVDNDLYHAHFELKHQNHKFIFGTFQHHGDTAFPYLTGGETGLLIDTW
PGEFLNPKEKAYSFRYEYDFKDYVPGLRFMTRYTTGHNIYAPNLGGTNLKERETDFDLGY
TVQSGWLKNLGLRARYAIYDNNMLSTANIKPVNETRLNIDYTWKFK
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgctctcaggttcagtgtgggctggcagttttattgataacagttcagtagaactcacc
acgcgaaatttctattttgaccgcgactaccaagagcaatccgcttaccctgctgccaag
gactggacacaagggtttattcttaaagccaattcaggttataccgaagggactgtcggt
ttcgggctggatgtgcttgcaacggcgggttttaaactcgatgccgatgccgagcacgga
ggtacaggaaacttacctagagacacccgcaccaatgagcctgctgactcttatggggaa
attggggtcacagcaaaagcgaaaatgagccagaccgagctacgcattggtaccctaatg
ccaatgaatcctgttttagtggcttcacctgctcgtttgcttcctcaaacttatcgagga
atttcactgaccagtaaagatattaaagattttgatttacaggcagcctacctcgataaa
gtgaatcatcgggattcgaccaactatgaaaaaattaaaatttcaggcgtaaatggacga
tttaaaagtgccgaaactgatggactctattatttaggtggaaactatcagtttaatcct
gcattgaagctcaccgctttttacatggatgttgatgatctttataaccaaaccatggtc
ggtgctttacaccaacacaaaattaatgacaccactaattttagctctcaattacgttac
taccgcagccgagatgacggacaagcaaaagcaggcttagtcgataatgatctttatcac
gcgcattttgaacttaaacatcaaaaccataaatttatttttggaaccttccaacatcac
ggcgacaccgcctttccatatttgactggcggtgaaactggcttactcattgatacatgg
ccgggcgagtttttaaacccaaaagaaaaagcctatagcttccgttatgaatatgacttt
aaagattatgttccgggtttacgttttatgacccgttacaccacaggtcacaatatttat
gcacccaacttaggcggaaccaatttaaaagaacgcgaaacagactttgatttaggctac
accgttcaaagtggctggttaaaaaatttagggttacgcgcacgctacgccatttatgac
aacaacatgctctctacagccaacatcaaacctgtaaacgaaacccgtctcaacatcgac
tacacatggaaatttaaataa

DBGET integrated database retrieval system