KEGG   Acinetobacter baumannii BJAB0715: BJAB0715_01303Help
Entry
BJAB0715_01303    CDS       T02727                                 

Definition
(GenBank) hypothetical protein
Organism
abab  Acinetobacter baumannii BJAB0715
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR MarR_2 HTH_24 TrmB HTH_27 SMC_ScpB Rrf2 HTH_Crp_2 DUF3375
Motif
Other DBs
NCBI-ProteinID: AGQ05949
Position
1375897..1376355
Genome map
AA seq 152 aa AA seqDB search
MVRSNLVQKKVEDEPKLSYMIARVDRIISKHLTEHLKELEITLPQFTALSVLASKSNLSN
AKLAERSFIKPQSANKILQDLLVNGWIEKKPDPTHGRRILITLTESGIEKLNKCNEVVLK
VEEKMLEGIDINLAYLIRNNLDIMVNNLKNFK
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggtacgttcgaatttagttcaaaaaaaagtagaagatgagcctaagttaagttacatg
attgctcgtgttgaccgaattattagtaaacatttaacggaacatttaaaagagcttgaa
attaccttaccgcaatttaccgcactttctgttttagcttcaaaaagtaatttatccaat
gccaagcttgctgagcgttctttcataaagccccaatctgccaataaaatcttgcaagat
ttactggtgaatggctggattgagaaaaaaccggacccgacacatggccgccgtatttta
attaccctgaccgaaagcgggattgaaaaattaaacaaatgcaatgaagtggttttaaaa
gtcgaagaaaagatgcttgaaggcattgatattaacttggcttatttgatccgtaataat
ctcgatattatggtcaataatcttaaaaattttaaataa

DBGET integrated database retrieval system