KEGG   Acinetobacter baumannii BJAB0715: BJAB0715_01337Help
Entry
BJAB0715_01337    CDS       T02727                                 

Definition
(GenBank) hypothetical protein
Organism
abab  Acinetobacter baumannii BJAB0715
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AGQ05983
Position
1413953..1414066
Genome map
AA seq 37 aa AA seqDB search
MRFFQKLNLVNWKPGDSSVIAPFFGLRTFIDNGSQTQ
NT seq 114 nt NT seq  +upstreamnt  +downstreamnt
gtgcgattctttcaaaaattaaatttagttaattggaaaccgggtgatagttcagttatt
gctccattctttggtctaagaacttttattgataatggaagtcaaacacaataa

DBGET integrated database retrieval system