KEGG   Acinetobacter baumannii BJAB0715: BJAB0715_01348Help
Entry
BJAB0715_01348    CDS       T02727                                 

Definition
(GenBank) Uncharacterized protein (competence- and mitomycin-induced)
  KO
K03743  nicotinamide-nucleotide amidase [EC:3.5.1.42]
Organism
abab  Acinetobacter baumannii BJAB0715
Pathway
abab00760  Nicotinate and nicotinamide metabolism
Brite
KEGG Orthology (KO) [BR:abab00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BJAB0715_01348
Enzymes [BR:abab01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.42  nicotinamide-nucleotide amidase
     BJAB0715_01348
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CinA
Motif
Other DBs
NCBI-ProteinID: AGQ05994
Position
complement(1425230..1425718)
Genome map
AA seq 162 aa AA seqDB search
MLQQCCQLLEDRLLKVAFIESASSGYLTSQFSIHKNSGADILLGGLVSYDPSIKISVLKV
DPKLIETYTAESPQVTEEMCRLGQTLFQQADIVVSCTGLLKPGGSENTEKPVGTFFICIS
YLGRIYHYHYFLSGHAEQKLKTLTQKVADSIIALISSNQHKS
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgcttcagcaatgctgtcagttattagaagaccgtttacttaaagtcgcatttattgaa
agtgccagttcaggttacttaaccagtcagttttcgattcataaaaatagtggtgctgat
attttactgggtgggttagtcagttatgaccccagtattaaaatcagtgttttaaaagtt
gatccaaagttaattgaaacctacacagcagaatcaccacaagtaactgaagaaatgtgc
aggcttggccaaaccctatttcaacaagctgacattgttgtgagctgcacaggtttatta
aaacctggcggaagtgaaaacacggaaaaacctgtaggtactttctttatctgtatttct
tatctaggacgtatttatcattaccattattttttatcaggtcatgccgaacaaaaactt
aaaactctcacacagaaagtagcagactcaattattgcgcttatatcttcaaatcagcat
aaaagttaa

DBGET integrated database retrieval system