KEGG   Acinetobacter baumannii BJAB0715: BJAB0715_01480
Entry
BJAB0715_01480    CDS       T02727                                 

Definition
(GenBank) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
abab  Acinetobacter baumannii BJAB0715
Brite
KEGG Orthology (KO) [BR:abab00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:abab02044]
    BJAB0715_01480
Secretion system [BR:abab02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BJAB0715_01480
SSDB
Motif
Pfam: T6SS_VipA DUF29
Other DBs
NCBI-ProteinID: AGQ06126
Position
1554808..1555311
AA seq 167 aa
MAKRESVQKKLQRIRPPRVQLTYDVEIGDAKEAKELPFVVGVMGDFSAASELERTKLKDK
KFINVDLDNIDEVMESLSPRAAFQVDNTLTEEGGKMAVDLTFKSMEDFRPENVVQQVDPL
KKLVEARERLTDLRNKISNSERLEDLLDEVLKNTDQIRKLSAEADHE
NT seq 504 nt   +upstreamnt  +downstreamnt
atggctaagagagaaagcgtacaaaagaagcttcagcgaattcgacctccacgtgttcag
cttacatatgatgtcgaaattggtgatgcgaaagaagcgaaagaactaccattcgttgta
ggtgtaatgggtgatttttcagctgcatctgagcttgaacgtacaaaattaaaagataaa
aaattcattaatgtcgatttagataatattgatgaagtaatggaatctctgtctccaaga
gctgcttttcaagtagacaatacgttgacagaagaaggcggtaaaatggctgttgattta
acgtttaagtcaatggaagattttcgcccggaaaatgttgtacagcaagttgatccatta
aagaaattggttgaggcgcgtgagcgtttaaccgatttaagaaacaaaatttcaaatagt
gagcgtttagaagatctgcttgatgaggttcttaaaaatactgaccaaatccgtaaatta
agtgcggaggccgatcatgaataa

DBGET integrated database retrieval system