KEGG   Acinetobacter baumannii BJAB0715: BJAB0715_01492
Entry
BJAB0715_01492    CDS       T02727                                 

Definition
(GenBank) hypothetical protein
  KO
K11902  type VI secretion system protein ImpA
Organism
abab  Acinetobacter baumannii BJAB0715
Brite
KEGG Orthology (KO) [BR:abab00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:abab02044]
    BJAB0715_01492
Secretion system [BR:abab02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BJAB0715_01492
SSDB
Motif
Pfam: ImpA_N
Other DBs
NCBI-ProteinID: AGQ06138
Position
1570919..1572013
AA seq 364 aa
MSIDISELLKPINDSLLCGEDYSFSNEFHEIKKARTQDDLLLDQGDWVAERKQADWDFVA
KSVSTLLIEKTKDIRLLTWVIEAWTHLNGFEGMVKGITLTHTMLNQYWQDIHPIIEDDDL
DQRIGLLQGLINQLPMLLKKVPLTNTAPYYNLLDYDNFLYHENIRRKQTEEYESQSGPSE
LEQFDQAIFNTSKTFQYSSYQEFNSVLTEWNVLKQTLDHLMGLDSPSFAAIDSAFETIHS
TLRKIYKAEAFGTGLAPSQEQAAVITTPSMENQVPVQIVSDQPMFQPQAQTHLANREQAM
KVLQEIADYFQANEPHSPVSYMLQKTIKWSQMPLHEWLAQVIKDEHPLQMVQEMLGVQPK
NEYE
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgagtattgatatttctgaactacttaaacccattaatgacagcttgctttgtggtgag
gattattcattttctaatgaatttcacgagataaagaaagccagaacacaggatgatcta
ttattagatcagggggattgggttgctgaacggaagcaggcagattgggactttgttgcg
aagagtgtaagcactttgctcattgaaaaaaccaaagatatccgtctattaacttgggta
atagaagcctggactcatctaaatggttttgaaggcatggtaaagggaatcactttaact
cataccatgctgaaccaatattggcaggatattcatccaattattgaagatgatgatttg
gatcagcgtattggtttattacaaggtcttattaatcagttgccaatgctgttgaagaaa
gtacctttaactaacacagctccttattataacttgcttgattacgataattttctatat
cacgaaaatatacgccgtaagcaaacagaagagtacgagagtcagtcaggtccatctgaa
ttagaacaatttgatcaagcgatctttaatacctctaaaacctttcaatactcaagttat
caagagtttaattcggttttaacggagtggaatgttttaaagcagacactcgaccattta
atgggattagattcaccgagttttgctgcaattgattctgcatttgaaacaatacacagc
actttacgtaaaatttacaaagcagaggcttttggtactgggcttgcgccgagccaagaa
caggccgctgtcatcacgacaccgtctatggaaaatcaagtgcctgtacaaatcgtatca
gaccagcctatgtttcagccacaagcacaaactcacttggccaatcgcgagcaagcaatg
aaagtgctgcaagaaatagctgattattttcaagcaaatgagccacatagtcctgtgagc
tatatgctccaaaagaccattaaatggagccaaatgccgctgcatgaatggttagcacaa
gtgattaaagatgagcatccattgcaaatggttcaggaaatgttaggtgttcaacctaaa
aatgaatatgaataa

DBGET integrated database retrieval system