KEGG   Acinetobacter baumannii BJAB0715: BJAB0715_01515Help
Entry
BJAB0715_01515    CDS       T02727                                 

Definition
(GenBank) NAD-dependent aldehyde dehydrogenase
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
abab  Acinetobacter baumannii BJAB0715
Pathway
abab00040  Pentose and glucuronate interconversions
abab00053  Ascorbate and aldarate metabolism
abab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BJAB0715_01515
   00053 Ascorbate and aldarate metabolism
    BJAB0715_01515
Enzymes [BR:abab01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     BJAB0715_01515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AGQ06161
Position
complement(1593767..1595347)
Genome map
AA seq 526 aa AA seqDB search
MLNITGQNFIAGQRSSAGSKFVLSYDAATDEALPYQFAQATPEEIDQAAQAAALAYPAFR
QTTPEQRAVFLETIASEIDALDDQFIATVCQETALPEARIRGERGRTTGQLRLFAQVLRR
GDYLGARIDLALPERQPLPRPDLRQYKIGVGPVAVFGASNFPLAFSTAGGDTASALAAGC
PVIVKAHSGHMATAESIANAICSAIEKCAMPKGIFSMIYGQGVGEPLVKHPAIKAVGFTG
SLKGGRALCDLAAARPEPIPVFAEMSSINPMILLPEALKVRGDKIATELSGSVVLGCGQF
CTNPGLIIGIKSPEFSQFLDHFKAAMAQQPPQTMLNKGTLRSYEHGLKELLAHDKIEHLA
GQPQQGPQAYPQLFKADVSLLLEHDELLQEEVFGPTTIVIEVESAEQLALALNGLRGQLT
ASLIAEPQDFENFATLIPLLEEKAGRLLLNGYPTGVEVCDAMVHGGPYPATSDARGTSVG
TLAIERYLRPVCYQNYPDHLLPLALQNTNPLGIARLVNGEMSKAAL
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgttaaatattactggtcaaaattttattgcaggtcaacgttcaagtgcaggcagtaag
tttgtattaagctacgatgctgcaacagatgaagcattaccctatcagtttgctcaggcc
actcctgaagaaattgatcaggcagctcaagcagctgcattggcttatccggcttttaga
caaactacgccagaacaacgcgctgtttttctagaaacgattgccagtgaaattgatgcg
cttgatgaccagtttattgcaacagtctgtcaagaaactgccttaccagaagcgcgtatt
cgcggtgaacgtgggcggaccacaggtcaattacgtctgtttgctcaagtattacgtcgt
ggtgactatttaggcgcccgtattgatttggctttacctgaacgtcaaccacttccacgt
ccagatttacgtcaatataaaatcggcgttggaccagtggccgtatttggtgcgagtaac
ttccctcttgccttttctactgcgggtggcgataccgcttcagcacttgcggctggatgt
cctgttattgtgaaggctcatagcggtcacatggcaacggccgaatcaattgcaaatgcc
atttgtagtgcgattgagaaatgcgctatgccaaaaggcatctttagcatgatttatggt
caaggtgtcggtgagccactggtaaaacatccagcaattaaagctgttggatttacaggt
tcacttaaaggtggtcgtgctctatgcgatttagctgccgcacgtcctgaacccattcct
gtttttgccgaaatgtcgagcattaacccaatgattttattacccgaagctttaaaagtg
cgtggtgataaaattgcgaccgaacttagtggttcagtggttttaggctgcggtcagttc
tgtaccaatccgggtttaattattggaattaaatcaccggaatttagccaattccttgac
catttcaaggctgcaatggctcagcaaccgccacaaactatgcttaacaaaggtacttta
agaagttacgagcatggtcttaaagaattactcgcacatgacaaaattgagcatttagcg
ggtcaaccccaacaaggtccgcaagcctatcctcaactctttaaagccgatgtatctctt
ttactagagcatgatgaattacttcaagaagaagtattcggccctactacgattgtgatt
gaagttgaatcggcagagcagcttgctctcgctttaaatggtctacgtggtcaacttaca
gcatcattaattgccgagccacaagattttgagaacttcgcgacccttattccattactc
gaagaaaaagcaggacgtttacttctaaatggttacccaacaggtgtggaggtctgtgat
gccatggttcacggcgggccatatcctgcaacttcagatgcacgtggtacatcggtagga
accttggcaatcgagcgttatttacgtccagtatgttatcaaaactatccagatcactta
ttgccactcgcccttcaaaataccaatccgcttggtatcgcgcgcttggttaatggtgaa
atgagtaaagctgctctttaa

DBGET integrated database retrieval system