KEGG   Acinetobacter baumannii BJAB0715: BJAB0715_02148Help
Entry
BJAB0715_02148    CDS       T02727                                 

Definition
(GenBank) Acyl CoA:acetate/3-ketoacid CoA transferase, beta subunit
  KO
K01032  3-oxoadipate CoA-transferase, beta subunit [EC:2.8.3.6]
Organism
abab  Acinetobacter baumannii BJAB0715
Pathway
abab00362  Benzoate degradation
abab01100  Metabolic pathways
abab01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:abab00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BJAB0715_02148
Enzymes [BR:abab01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.6  3-oxoadipate CoA-transferase
     BJAB0715_02148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans
Motif
Other DBs
NCBI-ProteinID: AGQ06794
Position
complement(2252457..2253110)
Genome map
AA seq 217 aa AA seqDB search
MSYQKLSRDQIAKRVAQDIPDGAYVNLGIGLPTKIASYLPADKDVFLHSENGLLAFGPPP
AAGEEDPELINAGKEFVTMLEGGSFFHHGDSFAMMRGGHLDIAVLGAFQVAANGDLANWH
TGAPNAIPAVGGAMDLAVGAKKVFITTDHVTKQGEPKIVAELTYPVTGKHCVDRIYTDLC
VIDVTKDGLKVIEKVEGLSFDELQALTGATLIDATQG
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgagctaccagaaactcagccgtgaccagattgcaaaacgtgtggcacaagatattccc
gatggcgcctatgtcaacttgggtattggtttaccgaccaagattgccagctacttacct
gccgataaagatgtcttcctacattctgaaaatggcctgttggcttttggcccaccgcca
gcggcaggtgaagaagaccctgaactgattaatgcgggtaaagagtttgtgaccatgctt
gaaggtggcagctttttccaccacggcgattcatttgccatgatgcgtggtggtcacctt
gatattgcggtgcttggggcatttcaggtggcagccaatggtgacttagcgaactggcac
acgggtgcacctaatgcgattcctgctgttggtggtgcgatggatttagcggttggtgcc
aagaaagtatttatcactacagaccatgtgaccaaacaaggcgagccaaagattgtcgct
gagctcacttatccggtaacgggtaaacactgtgttgaccgtatttacactgacctgtgt
gtgattgatgtgaccaaagacggtttaaaggtgattgagaaagtggaaggtcttagcttt
gatgagttacaggctttaacaggtgcaactttgattgatgcgactcaagggtaa

DBGET integrated database retrieval system