KEGG   Acinetobacter baumannii BJAB0715: BJAB0715_02645Help
Entry
BJAB0715_02645    CDS       T02727                                 

Definition
(GenBank) Lactate dehydrogenase-related dehydrogenase
  KO
K00090  glyoxylate/hydroxypyruvate/2-ketogluconate reductase [EC:1.1.1.79 1.1.1.81 1.1.1.215]
Organism
abab  Acinetobacter baumannii BJAB0715
Pathway
abab00030  Pentose phosphate pathway
abab00260  Glycine, serine and threonine metabolism
abab00620  Pyruvate metabolism
abab00630  Glyoxylate and dicarboxylate metabolism
abab01100  Metabolic pathways
abab01110  Biosynthesis of secondary metabolites
abab01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:abab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BJAB0715_02645
   00620 Pyruvate metabolism
    BJAB0715_02645
   00630 Glyoxylate and dicarboxylate metabolism
    BJAB0715_02645
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BJAB0715_02645
Enzymes [BR:abab01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     BJAB0715_02645
    1.1.1.81  hydroxypyruvate reductase
     BJAB0715_02645
    1.1.1.215  gluconate 2-dehydrogenase
     BJAB0715_02645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh F420_oxidored NAD_binding_2 AlaDh_PNT_C NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: AGQ07291
Position
complement(2724514..2725479)
Genome map
AA seq 321 aa AA seqDB search
MKKVVVFSQIDEEILSRLQQDYHVVVLNPKLSDINEQIRQEVVDADGMIGAGRLLNESNL
SPAQKLKIISSVTVGYDNYDVGYLDQKKIWLANTPHVLTETTADLAFTLLLSAARKVPFL
DHWTKQGEWKRTVGPQQFGLDVFGKTLGIIGLGNIGAAIARRGFYGFNMNIVYHNRREKP
ELAEPLKAQYLGLEELLQQSDFVVTAVDLNAESKALMGKAQFELMQKHAIFINIARGSVV
DEQALIEALQNEVIFAAGLDVYEKEPLQESALFTLPNVVTLPHVGSATAETRKKMANLAY
KNLVEALEGKTPRYLVNPNFV
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaggttgtggtttttagccaaattgatgaggaaattttgtcacggttacagcag
gattaccatgttgtcgtattgaaccctaaactgagtgatattaatgaacagatacgacaa
gaagtagtagatgctgatggaatgattggggcgggtcgtttgctcaatgaaagtaatctt
tctcctgcccaaaaattaaaaattatttcttctgtgactgtaggttatgacaattatgat
gttggttatttagatcagaaaaaaatctggttagcaaacacacctcatgttctaactgaa
acgacagcagatcttgcttttactttgttattaagtgcagccagaaaagttccttttcta
gatcactggactaaacaaggtgagtggaaaagaacagttgggccacagcagtttggtctc
gatgtttttggaaaaaccttaggtattattggacttggtaatattggagctgcaattgca
cgtcgtggcttttatggatttaacatgaatattgtttaccataatcgtcgcgagaaacct
gagttggcagaacctttaaaagctcaatatctggggttggaagaattattacaacaatct
gattttgtagtgacggctgttgacttaaatgcggaatctaaagctttaatgggtaaggct
caatttgagcttatgcaaaagcatgccatatttattaatattgcgcgtggctcagttgtc
gatgagcaagccctaattgaagcattgcaaaatgaagttatttttgctgctggtttagat
gtctatgagaaagaacctctgcaagaatctgcacttttcactttgccgaatgttgtcact
ttgcctcacgtaggttctgctacagctgaaacacgtaagaaaatggcaaatttagcttat
aaaaacttggtggaagcacttgaaggcaagacgcctagatatttagtgaatcctaatttt
gtgtaa

DBGET integrated database retrieval system