KEGG   Acinetobacter baumannii BJAB0715: BJAB0715_03252Help
Entry
BJAB0715_03252    CDS       T02727                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
abab  Acinetobacter baumannii BJAB0715
Pathway
abab00071  Fatty acid degradation
abab00072  Synthesis and degradation of ketone bodies
abab00280  Valine, leucine and isoleucine degradation
abab00310  Lysine degradation
abab00362  Benzoate degradation
abab00380  Tryptophan metabolism
abab00620  Pyruvate metabolism
abab00630  Glyoxylate and dicarboxylate metabolism
abab00640  Propanoate metabolism
abab00650  Butanoate metabolism
abab00900  Terpenoid backbone biosynthesis
abab01100  Metabolic pathways
abab01110  Biosynthesis of secondary metabolites
abab01120  Microbial metabolism in diverse environments
abab01130  Biosynthesis of antibiotics
abab01200  Carbon metabolism
abab01212  Fatty acid metabolism
abab02020  Two-component system
Brite
KEGG Orthology (KO) [BR:abab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BJAB0715_03252
   00630 Glyoxylate and dicarboxylate metabolism
    BJAB0715_03252
   00640 Propanoate metabolism
    BJAB0715_03252
   00650 Butanoate metabolism
    BJAB0715_03252
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BJAB0715_03252
   00072 Synthesis and degradation of ketone bodies
    BJAB0715_03252
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BJAB0715_03252
   00310 Lysine degradation
    BJAB0715_03252
   00380 Tryptophan metabolism
    BJAB0715_03252
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BJAB0715_03252
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BJAB0715_03252
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BJAB0715_03252
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:abab04147]
    BJAB0715_03252
Enzymes [BR:abab01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BJAB0715_03252
Exosome [BR:abab04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BJAB0715_03252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ketoacyl-synt Dodecin
Motif
Other DBs
NCBI-ProteinID: AGQ07898
Position
3389847..3391052
Genome map
AA seq 401 aa AA seqDB search
MSEAYIIDAIRTPRGKGKKDGSLYEVKPITLLTTLLNELQQRHQLDTSKVDDIVLGCVTP
IGDQGGDIAKTAAIAAGWNDDVAGVQINRFCASGLEAVNMAAMKVRSGWEDLVVAGGVES
MSRIPMGSDGGPWALDPETNLKSSFVPQGVGADLIATLDGYSREDVDNFAVKSQQKAAAA
QANGYFDQSVVPVKDHAGVVILEKDEFIKGNTTLEGLAKLNPSFEMMGQMGFDAVALQKY
PEAQKVNHVHHAGNSSGIVDGAALVLLASEKAVKEQNLKPRAKVLATALVGTDPTIMLTG
PAPAARKALEKAGLTIDDIDLFEVNEAFAAVVMRFINELNVPAEKVNVNGGAIALGHPLG
ATGAMILGTLLDELERQNKKRGLATLCVGGGMGIATIIERV
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaggcttatattattgacgccattcgcacaccacgcggaaaaggaaaaaaagac
ggctctctttacgaagtaaaaccaatcacattactcaccactctattaaacgaattacag
caacgccatcaactcgatacatctaaagtagatgatattgttctgggctgcgtcacacca
attggtgatcagggcggtgatattgccaaaacagcagcgattgcagcgggctggaatgat
gatgttgcaggtgtgcaaattaaccgcttttgtgcttcaggtttagaagcggtcaacatg
gcagccatgaaagttcgttctggttgggaagatttagtggttgctggtggcgttgaatca
atgtcacgtatcccaatgggttctgatggcggaccatgggccttagatccggaaaccaac
cttaaatcatcttttgttccacaaggtgttggcgctgacctcattgcaaccttagatggc
tatagccgagaagatgttgataattttgccgtaaagtcacaacaaaaagcagcggcagct
caagcaaatggttatttcgatcaatcagttgtgccagttaaagatcacgcaggtgttgtg
attttagaaaaagatgaatttattaaaggcaataccacacttgaaggtcttgcaaaactc
aacccaagttttgaaatgatggggcaaatgggctttgatgctgttgccctacaaaaatat
ccagaagcacaaaaagtaaatcatgttcatcatgccggtaactcatcaggtattgtcgat
ggagcagctctcgttttactggcttcagaaaaagcagtgaaagaacaaaacttaaaacca
cgcgctaaagttttggcgactgccctagtcggtaccgacccaaccatcatgttaactggc
cctgcccctgccgcacgcaaagctttggaaaaagctggtttaacaattgatgatattgac
ctatttgaagtcaacgaagcatttgcagctgtcgtgatgcgttttattaatgagctcaat
gtgcctgctgaaaaagtcaacgtaaatggcggtgcgattgctttaggccatcccttagga
gcaaccggtgccatgattttgggtacattacttgatgagcttgaacgtcaaaataaaaaa
cgcggtttagcaacgctctgtgtcggcggtggtatgggtattgccaccattattgaacgt
gtataa

DBGET integrated database retrieval system