KEGG   Luteitalea pratensis: LuPra_03604Help
Entry
LuPra_03604       CDS       T04394                                 

Definition
(GenBank) CO2+/MG2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
abac  Luteitalea pratensis
Brite
KEGG Orthology (KO) [BR:abac00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    LuPra_03604
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AMY10374
UniProt: A0A143PRD3
Position
4380411..4380800
Genome map
AA seq 129 aa AA seqDB search
MSSSTATTRGIRVSVDARFSAEHSAPERQHWFFLYTIKIENTGDLTVQLQARHWIITDGE
GHVEEVRGPGVVGEQPVLMPGESFEYTSGCPLTTPLGSMVGSYQMAAPTGETFDVEIGKF
DLRGPYTVH
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgagctcctcgaccgccaccaccagaggcattcgcgtcagtgtcgacgcacgcttctcc
gcagaacactccgctcccgaacgccagcactggtttttcctctacacgatcaagatcgag
aacacgggcgatctcacggtccagctccaggcccgtcactggatcatcaccgatggcgag
gggcacgtcgaggaagttcgcggccccggcgtcgtcggcgagcaaccggtgctgatgccc
ggcgagtcgttcgagtacacgtcggggtgtccgctcacgaccccgctcggatcgatggtg
ggcagctatcagatggcggcgcccacgggcgagacgttcgacgtcgaaatcggcaaattc
gacctgcgcggaccgtatacggtgcattga

DBGET integrated database retrieval system