KEGG   Luteitalea pratensis: LuPra_05446Help
Entry
LuPra_05446       CDS       T04394                                 

Gene name
ltaA_1
Definition
(GenBank) L-allo-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
abac  Luteitalea pratensis
Pathway
abac00260  Glycine, serine and threonine metabolism
abac01100  Metabolic pathways
abac01110  Biosynthesis of secondary metabolites
abac01120  Microbial metabolism in diverse environments
abac01130  Biosynthesis of antibiotics
abac01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:abac00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LuPra_05446 (ltaA_1)
Enzymes [BR:abac01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     LuPra_05446 (ltaA_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Aminotran_3 Cys_Met_Meta_PP DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AMY12173
UniProt: A0A143PVJ0
Position
complement(6418802..6419938)
Genome map
AA seq 378 aa AA seqDB search
MLSFSLFPFRPLLTSLLRPTSLLRPLSSVLSPPSLIDLRSDTVTRPTPEMRAVIAAAPVG
DDQFGEDPSVNALQDQGAALLGKEAALWLPTGTMANQVALRLLTQPGDDVIVSRESHLVW
HEAGAGAANSGIQFTEIGEAGSFSAEQFLAARKPRGHMLYPPTTLVSVENTHNRAGGIVL
TPDRTTAICAAAREHGVATLLDGARLWNAAVALRTTPAALAQPFDVVWAALSKGLGAPAG
SLLAGPRELIARAVRVRRMFGGAMRQVGLLAAAGSYAITSHYDRLADDHANARLIAERVA
QSPRVRLDIATVQTNIVVFHLEPGGPDAATVVARARERGVWLIAFGPRTLRVVTHLEVTC
AQCVEAAEILAELCGADA
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
gtgctgtccttctccctctttcccttccgccctcttctcacttctctcctccgtcctacc
tccctcctccgtcctctctcctccgtcctctctcctccgtccttgatcgatctccgctcc
gacaccgtgacgcggccgacgccggagatgcgagcggtgattgcggctgcgccggtcggc
gacgatcaatttggcgaggatccgtcggtcaacgcgctgcaggatcagggcgcggcactg
ctcggcaaggaggcggcgctctggttgcccacgggcaccatggccaaccaggtcgcgctt
cgtctcctcacgcagccgggcgacgacgtgatcgtgagccgggagagtcacctggtctgg
cacgaggcgggtgctggcgcggcgaactccgggatccagttcacggagattggcgaggct
ggatcgttttccgccgagcagttcctggccgcccgcaagccgcgtggacacatgctgtac
ccgcccacaacgctcgtctcggtcgagaacacccacaatcgcgccggcggcatcgtcctg
acgccggaccggaccacggccatttgcgccgccgcacgggagcacggcgtcgcgacgctg
ctcgatggcgcgcggctctggaacgctgccgtggcgctgcgcaccacgcccgccgcgctc
gcacagccattcgacgtcgtgtgggcggcgctgtccaaggggctcggcgcgccggccggg
tcgctgctggcgggtccgcgtgagttgatcgcgcgtgccgtgcgagtgcgacgcatgttc
ggcggggcgatgcgccaggtgggcctgctcgccgcggccggcagctacgccatcacctcc
cactatgatcggctggccgacgatcacgcgaacgcccggctgatcgccgagcgcgtggcg
cagtcaccgcgagtccgcctggacatcgcgaccgtccagaccaacatcgtggtgttccac
ctcgagccgggtggtccggatgcggcgacggtcgtggcccgtgcgcgcgagcgcggtgtc
tggctgattgcgttcgggccgcgcacgctgcgcgttgtcactcatctggaggtgacctgt
gcgcagtgcgtcgaggcggccgagatcctggccgagttgtgtggagcggatgcgtga

DBGET integrated database retrieval system