KEGG   Acinetobacter baumannii D1279779: ABD1_09620Help
Entry
ABD1_09620        CDS       T02491                                 

Gene name
aceA
Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
abad  Acinetobacter baumannii D1279779
Pathway
abad00630  Glyoxylate and dicarboxylate metabolism
abad01100  Metabolic pathways
abad01110  Biosynthesis of secondary metabolites
abad01120  Microbial metabolism in diverse environments
abad01200  Carbon metabolism
Module
abad_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:abad00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ABD1_09620 (aceA)
Enzymes [BR:abad01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     ABD1_09620 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase DUF3944 Nuc_rec_co-act
Motif
Other DBs
NCBI-ProteinID: AGH34852
Position
1072599..1074203
Genome map
AA seq 534 aa AA seqDB search
MTTYQTAIDAVRELKAKFGNTWADISPEDAARMQLQNRFKTGLDIAKYTAAIMRRDMAEY
DADSSKYTQSLGCWHGFIAQQKMIANKKYFGTTSKRYIYLSGWMVAALRSEFGPLPDQSM
HEKTSVPALIEEIYTFLRQADAKELNDLFRALNKAKEAGDSAKVAEITAQIDNFETHVVP
IIADIDAGFGNEEATYLLAKKMIEAGACALQIENQVSDAKQCGHQAGKVTVPHEDFIAKI
HALRYAFLEMGVEDGVIVARTDSEGADLTQKIPVVKEPGDIASKYISYLDTQEIDISEAQ
EDEILIKRDGKLHRPTRLASGLYQFREGTQIDRVVLDCITSLQNGADLLWIETPTPNVQE
IAHMVNRVKEVVPNAKLVYNNSPSFNWTLNFRQQAYDRWVAEGKDVSAYDRAKLMSAEYD
NTELAAEADEKIRTFQADAAREAGVFHHLITLPTYHTAALSTHELAQGYFGDQGMLAYVA
GVQRKEIRGGIACVKHQAMAGSDIGDDHKEIFAGENALKAGDDAKNTMNQFSAH
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgactacatatcaaacagcgattgatgcagtacgtgaattaaaagcaaaattcggcaac
acttgggcagacattagcccagaagatgctgctcgtatgcaacttcaaaaccgtttcaaa
acaggtttagatattgctaagtatacagctgcgattatgcgtcgtgatatggctgaatac
gatgctgattcaagcaaatatactcaatcattaggttgctggcatggtttcatcgctcaa
caaaaaatgattgctaacaaaaagtatttcggtacgacaagcaaacgttatatctacctt
tctggttggatggttgctgctcttcgttcagaatttggtccgcttcctgaccaatctatg
cacgagaaaacttcagtacctgctttgatcgaagaaatctacactttcttacgtcaagct
gatgcaaaagaattaaatgacttgttccgtgctttaaataaagcgaaagaagctggtgat
tctgcgaaagtagctgaaatcacagctcaaattgacaacttcgaaactcatgttgtgcca
attattgcagacatcgatgctggtttcggtaacgaagaagcaacttacttacttgctaag
aaaatgattgaagctggtgcttgtgcgcttcaaatcgaaaaccaagtatctgatgcaaaa
caatgtggtcaccaagctggtaaagtaactgttccacacgaagacttcatcgctaagatc
catgcacttcgttatgcattcttagaaatgggtgttgaagacggtgttatcgttgctcgt
actgactctgaaggcgctgacttaactcagaagatccctgtagttaaagagccaggcgat
atcgcatctaaatatattagctacttagatactcaagaaattgatatctcagaagctcaa
gaagatgagatcttaattaaacgtgatggtaaattacatcgtccaactcgtttagcttct
ggtctataccaattccgtgaaggcactcagattgaccgtgttgtacttgactgtatcact
agccttcaaaacggtgctgacttactttggatcgaaactccgactccaaacgtacaagaa
attgcacacatggttaaccgtgtaaaagaagtagttccgaatgcgaagcttgtttataac
aacagcccatcattcaactggactttaaacttccgtcaacaagcgtacgatcgttgggtt
gcagaaggtaaagatgtatctgcttacgaccgtgctaaattaatgagcgctgagtacgac
aatactgaattagctgctgaagctgatgaaaaaatccgtactttccaagcagatgctgcg
cgtgaagctggtgtgttccatcacttgatcacacttcctacataccacactgctgctctt
tctactcatgaattagcacaaggttacttcggtgaccaaggtatgttagcttatgttgct
ggcgtacaacgtaaagaaatccgtggcggtatcgcatgtgtgaaacaccaagcaatggct
ggttctgacatcggtgatgaccacaaagaaatcttcgctggtgaaaatgcacttaaagct
ggtgacgatgctaaaaacacaatgaaccaattctcagctcactaa

DBGET integrated database retrieval system