KEGG   Acinetobacter baumannii D1279779: ABD1_14680Help
Entry
ABD1_14680        CDS       T02491                                 

Gene name
gpo
Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
abad  Acinetobacter baumannii D1279779
Pathway
abad00480  Glutathione metabolism
abad00590  Arachidonic acid metabolism
abad01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abad00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    ABD1_14680 (gpo)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ABD1_14680 (gpo)
Enzymes [BR:abad01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     ABD1_14680 (gpo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AGH35354
Position
1579891..1580376
Genome map
AA seq 161 aa AA seqDB search
MSNIYQFEAELLEGDIKQFADYKGKVLLIVNTASKCGFTPQFAGLEKLYEKYKDQGLEVL
GFPCNQFGGQDPGSNKEIGTFCQRNYGVKFPMFAKVDVKGPEAHVIFRYLTREAKGILGS
STIKWNFTKFLVGKDGSVLNRYAPTTKPEALEADIEKALAS
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacatttatcagtttgaagctgaattgttagagggagatattaaacaattcgct
gattacaaaggtaaagttttattaattgtaaatactgcaagtaaatgtggttttactcca
cagtttgcgggcctcgaaaaactttatgaaaaatataaagaccaaggtttagaagtttta
ggttttccctgcaatcagtttggtgggcaagatcccggaagcaataaagagataggtaca
ttctgccagcgtaactatggagtgaaattccctatgtttgccaaagtagatgtaaaaggt
cctgaagctcatgtgatctttagatatttaacccgtgaagcaaaaggaattttaggaagc
agtactattaaatggaactttaccaagtttttagttggtaaagatggttcggttttaaat
cgttatgcgccaacaaccaagcctgaagcattggaagctgatattgaaaaagcattagcg
agttaa

DBGET integrated database retrieval system