KEGG   Acinetobacter baumannii D1279779: ABD1_23610Help
Entry
ABD1_23610        CDS       T02491                                 

Gene name
folE2
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
abad  Acinetobacter baumannii D1279779
Pathway
abad00790  Folate biosynthesis
abad01100  Metabolic pathways
Module
abad_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:abad00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ABD1_23610 (folE2)
Enzymes [BR:abad01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     ABD1_23610 (folE2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF OmpH Transposase_28
Motif
Other DBs
NCBI-ProteinID: AGH36246
Position
2554851..2555405
Genome map
AA seq 184 aa AA seqDB search
MSMQQSYANILTAVGEDLNRPGLKDTPVRAAKAFSYLTSGYSKTLEEVTNNAVFPSDNHE
MVLVKNIEFYSLCEHHLLPFYGRVHVAYLPEGKVLGLSKFARITEMFARRLQIQENLTQQ
IAEAVAEVTGARGVAVVIDSAHMCMMMRGVGKQESTTRTVSFVGDFKTDKEARREFLSAV
PESY
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatgcagcaatcgtacgcaaatattctgactgccgtcggtgaagaccttaatcgt
cccggccttaaagatacgcctgtgcgtgcggctaaagctttttcatatttaacttctggc
tatagtaaaactttagaagaagtcaccaataatgctgttttcccatcagataaccatgaa
atggtattggtgaagaatattgaattttattcgctctgcgaacatcatcttctcccattc
tatggccgtgttcatgttgcctatttaccagaaggcaaagttcttggcttatctaaattt
gcacgtattaccgagatgtttgctcgtcgtttgcaaattcaggaaaaccttactcagcaa
atcgcagaagctgttgcagaagtcacaggcgctcgtggcgttgctgtagtcatcgattca
gcacatatgtgtatgatgatgcgtggtgtaggtaaacaggaatctaccacccgtacagtt
tcatttgtcggagattttaaaaccgataaagaagcgcgccgtgaattcttaagtgcagta
ccagaaagctactaa

DBGET integrated database retrieval system