KEGG   Acinetobacter baumannii D1279779: ABD1_27970Help
Entry
ABD1_27970        CDS       T02491                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
abad  Acinetobacter baumannii D1279779
Pathway
abad00071  Fatty acid degradation
abad00072  Synthesis and degradation of ketone bodies
abad00280  Valine, leucine and isoleucine degradation
abad00310  Lysine degradation
abad00362  Benzoate degradation
abad00380  Tryptophan metabolism
abad00620  Pyruvate metabolism
abad00630  Glyoxylate and dicarboxylate metabolism
abad00640  Propanoate metabolism
abad00650  Butanoate metabolism
abad00900  Terpenoid backbone biosynthesis
abad01100  Metabolic pathways
abad01110  Biosynthesis of secondary metabolites
abad01120  Microbial metabolism in diverse environments
abad01130  Biosynthesis of antibiotics
abad01200  Carbon metabolism
abad01212  Fatty acid metabolism
abad02020  Two-component system
Brite
KEGG Orthology (KO) [BR:abad00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ABD1_27970
   00630 Glyoxylate and dicarboxylate metabolism
    ABD1_27970
   00640 Propanoate metabolism
    ABD1_27970
   00650 Butanoate metabolism
    ABD1_27970
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ABD1_27970
   00072 Synthesis and degradation of ketone bodies
    ABD1_27970
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ABD1_27970
   00310 Lysine degradation
    ABD1_27970
   00380 Tryptophan metabolism
    ABD1_27970
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ABD1_27970
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ABD1_27970
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ABD1_27970
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:abad04147]
    ABD1_27970
Enzymes [BR:abad01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ABD1_27970
Exosome [BR:abad04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ABD1_27970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ketoacyl-synt Dodecin
Motif
Other DBs
NCBI-ProteinID: AGH36680
Position
3055946..3057151
Genome map
AA seq 401 aa AA seqDB search
MSEAYIIDAIRTPRGKGKKDGSLYEVKPITLLTTLLNELQQRHQLDTSKVDDIVLGCVTP
IGDQGGDIAKTAAIAAGWNDDVAGVQINRFCASGLEAVNMAAMKVRSGWEDLVVAGGVES
MSRIPMGSDGGPWALDPETNLKSSFVPQGVGADLIATLDGYSREDVDNFAVKSQQKAAAA
QANGYFDQSVVPVKDHAGVVILEKDEFIKGNTTLEGLAKLNPSFEMMGQMGFDAVALQKY
PEAQKVNHVHHAGNSSGIVDGAALVLLASEKAVKEQNLKPRAKVLATALVGTDPTIMLTG
PAPAARKALEKAGLTIDDIDLFEVNEAFAAVVMRFINELNVPAEKVNVNGGAIALGHPLG
ATGAMILGTLLDELERQNKKRGLATLCVGGGMGIATIIERV
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaggcttatattattgacgccattcgcacaccacgcggaaaaggaaaaaaagac
ggctctctttacgaagtaaaaccaatcacattactcaccactctattaaacgaattacag
caacgccatcaactcgatacatctaaagtagatgatattgttctgggctgcgtaacacca
attggtgatcagggcggtgatattgccaaaacagcagcgattgcagcgggctggaatgat
gatgttgcaggtgtgcaaattaaccgcttttgtgcttcaggtttagaagcggtcaacatg
gcagccatgaaagttcgttctggttgggaagatttagtggttgctggtggcgttgaatca
atgtcacgtatcccaatgggttctgatggcggaccgtgggcgttagatccggaaaccaac
cttaaatcatcttttgttccacaaggtgtcggcgctgacctcattgcaaccttagatggc
tatagccgagaagatgttgataattttgccgtaaagtcacaacaaaaagcagcggcagct
caagcaaatggttatttcgatcaatcagttgtgccagtcaaagatcacgcaggtgttgtg
attttagaaaaagatgaatttattaaaggcaataccacacttgaagggttagcaaagctc
aacccaagttttgaaatgatggggcaaatgggctttgatgctgttgccctgcaaaaatat
ccagaagcacaaaaagtaaatcatgttcatcatgccggtaactcatcaggtattgtcgat
ggagcagctcttgttttactggcttcagaaaaagcagtgaaagaacaaaacttaaaacca
cgcgctaaagttttggcgactgcattagtcggtactgatccaaccattatgctgactggc
cctgcccctgccgcacgcaaggctttggaaaaagctggtttaacaattgatgatattgac
ctatttgaagtcaacgaagcatttgcagctgtcgtgatgcgttttattaatgagctcaat
gtgcctgctgaaaaagtcaacgtaaatggcggtgcgattgctttaggccatcccttagga
gcaaccggtgccatgattttgggtacattacttgatgagcttgaacgtcaaaataaaaaa
cgcggtttagcaacgctctgtgtcggcggtggtatgggtattgccaccattattgaacgt
gtataa

DBGET integrated database retrieval system