KEGG   Aerococcaceae bacterium ZY16052: CL176_01775Help
Entry
CL176_01775       CDS       T05652                                 

Definition
(GenBank) acetyl-CoA C-acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
abae  Aerococcaceae bacterium ZY16052
Pathway
abae00071  Fatty acid degradation
abae00072  Synthesis and degradation of ketone bodies
abae00280  Valine, leucine and isoleucine degradation
abae00310  Lysine degradation
abae00362  Benzoate degradation
abae00380  Tryptophan metabolism
abae00620  Pyruvate metabolism
abae00630  Glyoxylate and dicarboxylate metabolism
abae00640  Propanoate metabolism
abae00650  Butanoate metabolism
abae00900  Terpenoid backbone biosynthesis
abae01100  Metabolic pathways
abae01110  Biosynthesis of secondary metabolites
abae01120  Microbial metabolism in diverse environments
abae01200  Carbon metabolism
abae01212  Fatty acid metabolism
abae02020  Two-component system
Brite
KEGG Orthology (KO) [BR:abae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CL176_01775
   00630 Glyoxylate and dicarboxylate metabolism
    CL176_01775
   00640 Propanoate metabolism
    CL176_01775
   00650 Butanoate metabolism
    CL176_01775
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CL176_01775
   00072 Synthesis and degradation of ketone bodies
    CL176_01775
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CL176_01775
   00310 Lysine degradation
    CL176_01775
   00380 Tryptophan metabolism
    CL176_01775
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CL176_01775
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CL176_01775
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CL176_01775
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:abae04147]
    CL176_01775
Enzymes [BR:abae01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CL176_01775
Exosome [BR:abae04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CL176_01775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AXY24848
UniProt: A0A347WIE1
Position
369402..370583
Genome map
AA seq 393 aa AA seqDB search
MNDVVIVAAQRTAIGAFGGMFKEKSAVDLGADLLRATLGQIELDPEQVDEVIIGNVLGAG
LGQNVARQVAVKAGLPVHVPAFTVNKVCGSGLKAVTLAAQAIKAGDAEVVVAGGTENMSQ
APYIQTGARWGQRMGDARLVDTLLKDGLTDAFSQEHMGLTAEYLAEAHDITREQQDTLAA
QSQQKAEAAIQAGKFKAEILPIEVPQARGESQIVDQDEYPRAGTTLERLAQLKPAFKKEA
GTVTAGSSSGINDGAAILILMREAKAVELGLPVLARIRAYASAGVEPQLMGAGPIPATQK
ALAKAGLSVADLGRVEANEAFASQAFHVIQTLGIDPDIVNVNGGSIALGHPIGASGARIL
VTLVHEMRRSKVQYGLATLCIGGGQGIAMVVEQ
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatgtagtgattgtggcggcccagcgtacggcgattggggcgtttggaggcatg
tttaaggagaagagtgccgtcgatttgggggcagatttgctccgagcaaccctaggtcaa
atagagctagatccggaacaggtcgatgaagtcattatcggcaacgtcttaggtgcaggc
ctaggtcagaatgtcgctcgtcaagtggcggtaaaggcgggcttgccggtgcatgtgcct
gcttttacggtgaataaggtgtgcggttcaggtttgaaggcggtaaccttagctgcccaa
gcaattaaagcgggagatgctgaggttgtcgtggcaggtggtacggagaatatgtcccaa
gcaccttatattcaaacaggagcccgctgggggcagcgtatgggagacgcccgtctagtg
gataccttgctaaaggacggcttgaccgatgcctttagtcaggagcatatggggctgact
gccgaatacttggctgaggctcatgatattacgcgcgagcagcaagatactttagccgca
caaagtcagcagaaagccgaagcagccatccaagcggggaaatttaaggctgaaattctg
cccattgaagtaccgcaagcccgtggtgagagccagattgttgaccaagacgaatatccc
cgggctggtacaactttagagcgactcgcccaactcaaacccgctttcaaaaaagaagcc
ggtacagtcaccgccggctcgtcttctggtattaacgacggggcagcgattcttattttg
atgcgggaggctaaggcagttgaattaggtttgccggtccttgcccgtattcgcgcttat
gctagcgctggggtagagcctcaattaatgggcgctggaccgattcctgccacacaaaaa
gcattggctaaggctggcttgagtgttgcggacttaggtcgggtcgaagcgaatgaagct
ttcgcctctcaagcttttcatgtcatccaaactttaggtattgaccccgatattgtgaat
gttaacggtggttctattgctctcggccatccaatcggggccagcggagcacgtattctg
gtaactttagtccatgaaatgcgtagatctaaagtgcagtacggcctggctaccctgtgt
attggtggtggtcaagggattgctatggtcgtggagcagtaa

DBGET integrated database retrieval system