KEGG   Aerococcaceae bacterium ZY16052: CL176_07845Help
Entry
CL176_07845       CDS       T05652                                 

Definition
(GenBank) glycine--tRNA ligase subunit beta
  KO
K01879  glycyl-tRNA synthetase beta chain [EC:6.1.1.14]
Organism
abae  Aerococcaceae bacterium ZY16052
Pathway
abae00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:abae00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CL176_07845
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:abae01007]
    CL176_07845
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:abae03016]
    CL176_07845
Enzymes [BR:abae01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     CL176_07845
Amino acid related enzymes [BR:abae01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   CL176_07845
Transfer RNA biogenesis [BR:abae03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    CL176_07845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_synt_2f DUF1040
Motif
Other DBs
NCBI-ProteinID: AXY25916
UniProt: A0A347WLF9
Position
complement(1678917..1680956)
Genome map
AA seq 679 aa AA seqDB search
MADYLLEIGMEEIPARFVLSLRDQLAERVEAFLEENRLSYTSIDRFATPRRLAVRVNGLA
EQQEAIQEHNRGPALHIAKDDQGAWTKAALGFARGQGIEVDDLLEEDVNGTMYVFADKYV
EGLASEEVLKDIDQVIKAMTFPVSMRWHDYDVAYIRPVHWLISLYNSKVLPLSFVGVKAG
NQTRGHRFIGKNVQLSHPSEYESALRNEQVIASFEKRQDTISQQVEAIAQENGWHVPQDS
DLLEEVTAIVEWPTAFYGQFDENYLQVPSIILKTAMRDHQRYFYVEDTKGELLPYFISVR
NGNEEHIENVIKGNLKVLKARLEDALFFYEEDLKLPLETYVAKLEHVNEHYKLGSLADKQ
VRVKALIEEQFLPHLTGALESEAGQAASQAAEIYKYDLMTLMVDEFSELQGTVGELYGEH
YGLSKAIAQAIGSQYMPTQSGGSLPDTQAGALLAAADKLDTLMQYFQAGLIPTGSNDPYA
LRRQASGLVEIIWDQQWDFDLLAVIEKEMTESSERQQLIEFIQARIIQHLQQDGIAHDII
QGATSANHLNVLETIQVATNLQAKRKEAPEAYRQFVEAMSRVLNLGSQVEITGAMNPDLA
ETESETALIQAIQDLSQEGSIAEQLQQLHDLVPVISDYFENNMVNAEDATIRHNRQVTLA
NLSQWILNLVDARALISKF
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atggcagattatttattagaaattggaatggaagaaattccagcacgctttgtcctctcc
ttaagagatcaattagcggagcgtgttgaggcatttctggaagagaatcgtttatcttat
acttctatcgatcgctttgcgacacctcgtcgcttagccgttcgtgtgaatggcttggca
gagcaacaagaagccattcaagagcataatcgtggtcctgctttacatattgctaaagat
gaccaaggggcctggactaaagcagctttaggttttgcccgcggtcaaggaattgaagtg
gatgatttgcttgaagaagatgtgaatggaacgatgtatgtctttgctgacaaatatgtg
gaaggtttagctagtgaagaagtgttgaaagatattgatcaagttatcaaggcgatgact
ttcccagtatcgatgcgttggcatgactatgacgtagcttatatccggccggtacactgg
ttaatatctttatataattcaaaggtgttgccattaagttttgtaggggtgaaggcgggt
aatcaaacacgaggccaccgcttcattggtaagaatgttcaactttcgcatccgagcgaa
tatgagagtgccttgagaaatgagcaggttatcgcaagctttgagaagcgccaagacact
attagtcaacaagttgaggccattgcccaagagaatggctggcatgtgccccaagattct
gatttattagaagaagtaactgccattgttgaatggccaaccgccttctacgggcaattt
gatgagaattacttacaagtaccaagtattatactcaagacagcgatgcgcgatcaccag
cgttatttctatgtggaagacaccaagggtgagctgctgccatatttcatttccgtacgc
aatgggaatgaagagcatattgagaatgttattaaagggaatctcaaagtactaaaggca
cgactcgaagacgccttattcttctatgaggaagacttgaagttaccattggaaacttat
gttgctaaattggagcatgtgaacgaacattataaacttggctctttagcagacaagcaa
gtgcgtgtgaaagctttaattgaagagcaattcttaccgcatttaacaggagcactagag
tctgaagcagggcaagcagcaagccaagcggctgaaatatataaatatgatttaatgacc
ttgatggtggatgaattctcagagctacaaggcacggttggcgagttgtacggggaacac
tacggactttctaaagctattgctcaggcgattggcagccaatatatgcctacccaaagt
ggcggatccttaccggatactcaagctggtgcgctcttagcagcagcggataaattagat
actttaatgcagtacttccaggcgggtcttattccaactggttctaacgacccatatgcc
ttaagacggcaagctagtggcttagttgaaattatttgggatcagcagtgggactttgac
ttattagctgttatcgagaaagaaatgacagaaagttcagagcgccagcaattaattgaa
tttattcaagcacgtattatccagcatttacaacaagatggcattgctcatgatattatc
caaggagcgacctcagccaatcacttaaatgtattagagacgatccaagttgccacaaac
cttcaggcgaaacgtaaggaagctccagaagcgtatcgtcaatttgttgaagccatgagt
cgcgtcttaaacttaggtagccaagtcgaaataaccggcgcaatgaatccagacttagct
gaaacagaatccgaaacagcgctgattcaagcgattcaagacctttcccaagaaggttca
attgctgagcaacttcaacaattgcatgacttggtgccagtgattagtgattatttcgaa
aataatatggtgaatgctgaagatgccacaatccgccacaatcgtcaagtaaccttagcg
aacttgagtcaatggatacttaatttagtagatgcacgcgccttaattagtaaattttaa

DBGET integrated database retrieval system