KEGG   Aerococcaceae bacterium ZY16052: CL176_08155Help
Entry
CL176_08155       CDS       T05652                                 

Definition
(GenBank) UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
abae  Aerococcaceae bacterium ZY16052
Pathway
abae00471  D-Glutamine and D-glutamate metabolism
abae00550  Peptidoglycan biosynthesis
abae01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abae00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    CL176_08155
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CL176_08155
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:abae01011]
    CL176_08155
Enzymes [BR:abae01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     CL176_08155
Peptidoglycan biosynthesis and degradation proteins [BR:abae01011]
 Precursor biosynthesis
  Amino acid ligase
   CL176_08155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C Mur_ligase DUF1188 DAO_C
Motif
Other DBs
NCBI-ProteinID: AXY25972
UniProt: A0A347WLL5
Position
complement(1750147..1751526)
Genome map
AA seq 459 aa AA seqDB search
MTKDFKDKRILVLGYAMTGRSVANFLSKEGAIVTVNDGGQLTDDPSVEALEAQGVSFVTG
GHPIELLDQDFAFIVKNPGIPYDIPFLKEATKRQIPIYTDIELASWVTEADIIAVTGSNG
KSTTTSLIYELLKELPEGETYLAGNIGIPTMDVVQKAQAGDRIVMEVSSFQLAGTRYFKP
NIAVIVNIYSAHLDYHGSREAYIEAKLKLIENMGSEETIVYNADQEELAHLLQDYSSVKL
PFSMDADIEAGAYLLGDQMMYEGEAIFAAKDLQIPGKHNVSNALAAIAVAKQLGVSNEAI
GRVLAEYGGMPHRIQPVTQVSGRRFINDSKATNTTATITALKSFTEPIIYIGGGLDRGNG
FDDLIPYLSNVKAAYVYGETQAKLKESFTKAAVPEISCFETLDEATKAAYRKAAAGDVVL
FSPSCASWDQFDNFEVRGEHFVAILEQLIQEEPYEPKEV
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgactaaagatttcaaagataaacgaattcttgtcttaggctatgccatgactggacga
agtgtcgcaaactttcttagtaaagaaggggcaattgtgacggttaatgatggcggtcag
ctcacggatgacccctctgttgaggcacttgaagcccaaggtgtctcttttgtaacggga
ggccatcccattgaactactagaccaagatttcgcctttattgtcaagaatccaggcatt
ccctatgatattcctttcttaaaagaagcaacgaaacgtcaaatccctatctatactgat
attgaactggcttcctgggtgactgaggcagatattattgctgtaacaggtagcaatggc
aagtcgacgacaacttccctaatctacgaattacttaaggaattacccgaaggtgaaacg
tatttagcgggaaatattggcattcctacgatggatgtcgttcaaaaagctcaagcagga
gaccggattgttatggaagtttccagttttcaattggcaggtacccgttatttcaaaccg
aacattgctgtcattgtaaatatttactcggctcacctagattatcatggcagtcgggag
gcttatattgaagcgaaattaaagctgattgagaatatgggaagcgaagaaaccattgta
tataacgctgatcaagaagagcttgcccatttacttcaagactactcctcggtgaaactt
ccgtttagtatggacgctgatatagaagcaggcgcttatttattaggtgaccagatgatg
tatgaaggcgaagcaatctttgcagcgaaagacttacaaatacctggtaaacataacgtc
agcaatgccttggctgcgatagcagtagcgaagcaattaggggtaagtaatgaggcgatc
ggtcgtgttctcgcagaatatggcggaatgcctcaccgtatccaaccggttacccaagta
agtggcagacggttcattaatgattcgaaggcaacaaatacgacagcgacaattacagcg
ctaaagagtttcactgaaccaatcatttacattggtggtggcttagatcggggcaatggt
tttgatgatttaataccttatctatccaatgtgaaggcggcttatgtttacggagaaaca
caagctaaattaaaagaaagcttcaccaaagcagctgttccagagatttcttgctttgaa
accttagacgaagctactaaggcagcttaccgaaaagcagcagcaggcgatgtggtgtta
ttctcaccaagttgcgcaagttgggatcagtttgataatttcgaagttcgtggcgagcat
ttcgtggccattcttgagcaacttatccaagaagaaccttatgaaccaaaggaggtttaa

DBGET integrated database retrieval system