KEGG   Aerococcaceae bacterium ZY16052: CL176_08220Help
Entry
CL176_08220       CDS       T05652                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA reductase, degradative
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
abae  Aerococcaceae bacterium ZY16052
Pathway
abae00900  Terpenoid backbone biosynthesis
abae01110  Biosynthesis of secondary metabolites
abae01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:abae00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CL176_08220
Enzymes [BR:abae01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     CL176_08220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: AXY25984
UniProt: A0A347WLM7
Position
complement(1762442..1763686)
Genome map
AA seq 414 aa AA seqDB search
MTEIFSGFYKRTPEERLAIVQEAGFVGQSEVPSLPKDIANQMIENFVGSYQLPMGLAVNV
QVNGQAYAVPMAIEEPSVIAAVANGGKILGNIDSKAYNRELIGQIIIQDLANLQEAKQML
EAQTDKLLHKAAEVSQSMIQRGGGPRKIWVEVVEDFLTLYLSLDSCDSMGANLMNTILEH
LVPSVETLTQGKVLMGILSNYSTEANVTAKVKVPLTRLSAEADEALQMAERIAAASSYAQ
LDPYRAATHNKGIMNGIDAVLIATGNDWRAVEAGVHAYAVQAGQYRGLSRWWLNDDQTAL
HGELSLPLYLATVGGSLSNHPTAQWALDLLGRPSGDGLSEIIAAVGLIQNFSAVRALVTT
GIQKGHMRMQARSLAMQAGARTDNVSEVVEALMQAPLMNLSAANDIVRKVQGED
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
ttgacagagatatttagtggtttctacaaaagaacacctgaagaacgcctagccattgtt
caagaggcaggttttgtaggccaaagtgaagttccttccttacccaaagatattgccaat
caaatgattgagaatttcgtcggctcttatcaacttccgatgggcctagcagtgaatgta
caagtaaatggacaagcctatgccgtgcctatggccattgaagaaccatctgtaattgcc
gcagtagccaatggtggcaaaattcttggcaacattgacagtaaagcctataaccgagaa
ttaatagggcaaatcataattcaagacttagcaaatttgcaagaagctaagcagatgctt
gaagcgcagacggataaactcttacacaaagccgctgaagtatcccaaagtatgatccaa
agaggaggcggccctcgcaaaatctgggttgaagtcgtagaagatttcctaacgttatac
ttatcgctagattcttgcgactcaatgggcgcaaacttaatgaatacgattcttgaacat
ctggtgccaagcgtagaaacgttaacgcaaggcaaggtgctaatggggattctatctaat
tattccacagaagcgaatgttaccgctaaggtaaaggtaccactgacgcgattatcagct
gaagcagatgaggcgcttcaaatggctgagcgaattgcagcggcctcatcttatgcacaa
ctcgatccctaccgggctgccacccataacaaaggtattatgaacggcatcgacgcagta
ttaattgcaaccgggaatgattggcgggcagtggaagcgggtgtacatgcctatgcagta
caagctggtcaatatcgtggcttgagccgctggtggcttaacgatgatcaaacagctttg
cacggggaattatcactgccgttatatttagcaacagtcggtggttcattgagcaatcat
ccaacggcacaatgggcacttgatttacttggtagaccaagcggggatgggttatctgaa
atcatagccgctgttggcttgatacagaatttctcagctgtgcgtgccttagtgaccacg
ggtattcaaaaggggcacatgcggatgcaagctcggtctttggcaatgcaagcaggggca
aggactgacaatgtgagtgaagttgttgaagcgttaatgcaagcacccctcatgaatctt
agtgctgcaaatgatattgtaagaaaggtgcaaggagaggactga

DBGET integrated database retrieval system