KEGG   Actinobacteria bacterium IMCC26256: IMCC26256_111866Help
Entry
IMCC26256_111866  CDS       T03963                                 

Definition
(GenBank) 3,4-dihydroxy-2-butanone 4-phosphate synthase
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
abai  Actinobacteria bacterium IMCC26256
Pathway
abai00740  Riboflavin metabolism
abai00790  Folate biosynthesis
abai01100  Metabolic pathways
abai01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:abai00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    IMCC26256_111866
   00790 Folate biosynthesis
    IMCC26256_111866
Enzymes [BR:abai01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     IMCC26256_111866
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     IMCC26256_111866
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase
Motif
Other DBs
NCBI-ProteinID: AKL74134
UniProt: A0A0G3V4W1
Position
1970852..1971475
Genome map
AA seq 207 aa AA seqDB search
MSTFASIEEAIDRIRAGEMVLVADDEDRENEGDLTMAAEFVTPEAINFMLRFARGLVCMP
SAPEYLERLAIGPMIPAGEEGCDTPFTVSIDHRDSGSGIGAADRARTVKNFLDPASVAAD
FIRPGHVFPLRAKPEGVLERRGHTEASVDLARLAGLQPVAVICEVLDDDGSPARLPFLEK
FAAEHGILLISVEQLAEYREAALTSTS
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgagcacattcgccagcatcgaggaagccattgaccgcattcgtgcgggggagatggtt
cttgtggccgatgacgaagatcgtgagaatgaaggcgacctaacaatggccgcggagttt
gttaccccagaagcgatcaacttcatgctccggttcgcacgcggtctcgtatgcatgcct
tctgcgccggagtatcttgagcgcctcgcgattgggccaatgattcctgcgggagaagaa
ggctgcgacacgcccttcactgtctccattgatcaccgcgactcggggagcggaattggc
gccgccgatcgggctcgaacagtgaagaatttcttagacccagcatcagtcgctgccgac
ttcatccggccagggcatgtcttccctcttagagcaaagcccgagggagtgctagagcgc
cgcggacatactgaggcgtcggtagatttggctcgcctcgcagggctccaacctgtagca
gttatctgtgaagtgctcgatgacgacggctcgccggcacgcctacccttcttagagaag
ttcgctgcagagcacgggattttactcatcagcgttgagcaactcgcggagtatcgagag
gcagcactcacctcaacaagttag

DBGET integrated database retrieval system