KEGG   Actinobacteria bacterium IMCC26256: IMCC26256_111897Help
Entry
IMCC26256_111897  CDS       T03963                                 

Definition
(GenBank) amidase, Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit
  KO
K01426  amidase [EC:3.5.1.4]
Organism
abai  Actinobacteria bacterium IMCC26256
Pathway
abai00330  Arginine and proline metabolism
abai00360  Phenylalanine metabolism
abai00380  Tryptophan metabolism
abai00627  Aminobenzoate degradation
abai00643  Styrene degradation
abai01100  Metabolic pathways
abai01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:abai00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    IMCC26256_111897
   00360 Phenylalanine metabolism
    IMCC26256_111897
   00380 Tryptophan metabolism
    IMCC26256_111897
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    IMCC26256_111897
   00643 Styrene degradation
    IMCC26256_111897
Enzymes [BR:abai01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     IMCC26256_111897
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AKL74165
UniProt: A0A0G3V3X7
Position
1999895..2001379
Genome map
AA seq 494 aa AA seqDB search
MSSNNSSSNNSSSNNPSVSNRAINELDAVAQAELVRSGDASPSELVEAAIARIDEVNPVL
NAVIHDLRERARAEAADPALPDGAFRGVPFVVKDLDGPLGGAPYHNGNKLLKELGYIAPT
DSTLVAKMRAAGMIAIGKTNTPEFGLQPTTEPEAYGPTHNPWSLAHGPGGSSGGSGAAVA
AGMVAVGHAGDGGGSIRIPASANGLVGLKASRGRISLGPDEGEPWNGFVMRGVLTRSVRD
SGALLDVIAGAVPGDPYAAPSRHGSYANAVTTDPGSLRIGILTSAPSAMCETHPDCVAAT
EEAGRMLESLGHRVEVSSPDALAEDLLTNFLTILSTNVAADLDEIADIAGRAVTAADVEA
ITWSYAEMGRAITGVQVQASLRSIHAWTRRMLSWWDEFDLLLTPTLAEPPPLLGDLARPD
DPGTAAARATPFVAYCAPFNVTGQPAISVPTNISPSGLPIGIQLVSGAWREDLLLSVAGQ
LEQAMPWAQRRPSL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcaaataactcgtcttcaaataactcgtcctcaaataacccgtccgtaagtaac
cgcgcaatcaacgaattagatgctgttgctcaggctgagcttgtgcgctccggagacgca
agcccatccgagttagtcgaggcagcgatcgcccgcattgatgaggtgaacccagttctc
aatgctgttatccacgacctgcgcgagcgtgcacgcgcggaggccgcggatccggcgctc
cccgatggagcatttagaggagtgccgtttgtagtcaaggacctagatggtccactcggt
ggggctccgtatcacaacggaaataaattgctaaaagaacttggctacatcgccccgacc
gacagcacactcgtagcgaagatgcgcgctgcgggcatgatcgcaatcggtaagacgaat
acacctgagtttggtctgcagcccactactgagcccgaggcatacggcccaacccacaac
ccgtggagccttgcgcatggcccgggcggatcatcgggtggatccggtgcagcggtcgct
gcagggatggtcgcagttggccacgctggcgatggtggtggatctattcgcatcccggca
agcgctaatgggttagttgggcttaaggcgagccgaggtcgtatctcgcttgggccagac
gagggcgagccttggaacggttttgttatgcgtggcgtgctcactcgcagtgtgcgcgac
tcgggtgcgctccttgatgtgatcgcaggagctgtgccaggcgatccatacgctgcgcct
agtcgacatggttcatatgccaatgcagttactaccgatccagggagtcttcgcatcggc
atcttgactagcgctccaagcgccatgtgcgagacacacccagactgcgttgcggctacc
gaggaggcagggcggatgctcgagtcgcttggacatcgcgtagaggtctcgtccccggat
gcgttagcggaggatctgctcacaaacttccttacaattctctcgaccaatgttgctgca
gacctagatgaaattgccgatattgcagggcgcgcggttaccgcagctgatgtcgaggca
attacgtggagttacgcagagatgggtcgggcaattaccggtgtgcaggtacaggcatcg
cttcgatcaatacatgcatggactcgccgaatgctctcatggtgggatgagtttgatctc
ctcctaaccccgacgctcgcggaaccaccaccactactcggggaccttgctcgaccagat
gaccctggaacagcagcggcccgagcgactccattcgttgcctactgtgcgccattcaac
gtcacagggcagcctgcaatttcagtccctacgaatatctcgccctccgggctgcccatc
gggattcaacttgtgagtggcgcttggcgcgaggatctactcctctctgttgccgggcaa
ctcgagcaggcaatgccgtgggcgcagcgtcgcccctctctctaa

DBGET integrated database retrieval system