KEGG   Actinobacteria bacterium IMCC26256: IMCC26256_112147Help
Entry
IMCC26256_112147  CDS       T03963                                 

Definition
(GenBank) ribosomal protein L22, bacterial type
  KO
K02890  large subunit ribosomal protein L22
Organism
abai  Actinobacteria bacterium IMCC26256
Pathway
abai03010  Ribosome
Brite
KEGG Orthology (KO) [BR:abai00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    IMCC26256_112147
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:abai03011]
    IMCC26256_112147
Ribosome [BR:abai03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    IMCC26256_112147
  Bacteria
    IMCC26256_112147
  Archaea
    IMCC26256_112147
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AKL74415
UniProt: A0A0G3V4N5
Position
complement(2254693..2255283)
Genome map
AA seq 196 aa AA seqDB search
MRSDVQGTQATLSHCGIAPNKVRAVLGLIRGLGIDEARDVLQFCERGAAEEIGKLLNSAI
ANAEHNDHLDPEELFVSACWADEGPTAKRWRPRARGRATKIRKRTSHITIVVDRMPDEAL
ELHRARSERRGGGGATQANRARRRAASRAAEAQAEHNHDHDHDHDHDHEHDHSEPEEAPV
AESAESEVAETTEASE
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgaggtctgacgttcaaggcacacaagcaaccctgagccactgcggcattgcacctaac
aaggtgcgtgcagtccttgggctcatccgcggactcggtattgacgaggctcgcgatgta
cttcagttctgtgaacgcggtgctgcagaagagattggcaagttgctgaactcagcaatc
gccaatgccgagcacaacgatcatctcgaccctgaggagctattcgtcagcgcctgctgg
gccgatgaaggacctactgcgaagcgttggaggccacgtgctcgtggacgcgccacaaag
attcgcaagcgcaccagccacatcacaattgtcgtagaccgcatgcccgatgaggctctt
gagcttcaccgtgcgcgttccgagcgacgcggtggaggcggagcgactcaagccaaccgt
gcgcgccgacgtgctgcatcacgtgcagcagaggctcaggccgagcacaaccacgatcac
gatcatgaccatgatcatgaccacgaacacgaccacagcgagccggaggaggccccagtg
gctgagtcggctgagtctgaggtcgcggagaccacggaggcgtccgagtaa

DBGET integrated database retrieval system