KEGG   Acinetobacter baumannii BJAB0868: BJAB0868_01410
Entry
BJAB0868_01410    CDS       T02728                                 

Definition
(GenBank) hypothetical protein
  KO
K11900  type VI secretion system protein ImpC
Organism
abaj  Acinetobacter baumannii BJAB0868
Brite
KEGG Orthology (KO) [BR:abaj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:abaj02044]
    BJAB0868_01410
Secretion system [BR:abaj02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BJAB0868_01410
SSDB
Motif
Pfam: VipB VipB_2 TssC
Other DBs
NCBI-ProteinID: AGQ09959
Position
1491485..1492966
AA seq 493 aa
MNNTQSAAMPLVENEEVNLLDSIVEQSRIARNEEEHSRAKSLIGELAKEVMAGTITVSEN
MTLSIDKRIAEIDALISKQLSQIMHNEQFQKIESTWRGLYYFCQETPSNPLIKIRMLNTT
KKELVKDFQGATDFDQSTLFKKIYEEEYGSFGGAPYSALIGDFEFDRTPSDMYLLEQISH
VAAAAHAPFISAASPSILGLESFTDIDRPRDVSKIFETAEYVQWRSFRDSEDSRYVALTL
PHVLGRLPYHPKEGTATEGFNFIEDVSGENHNEYLWMNAAYAFGTRLTNAFDMHGWCAAI
RGVEGGGLVEGLPVHTFKTQDGEVVFKCPTEIAITDRREKELSDLGFIPLVHCKNTDYAA
FFGAQSTQKPKKYDNDTANANSALSSQIQYIMAVSRIAHYLKAMMRDKVGSFASAGNVEA
FLNEWLSQYVLLDDGASQEAKAQYPLREASVKVVEDPAQPGHYKSVVFLRPHFQLDELSV
SLRLVTELPQSSN
NT seq 1482 nt   +upstreamnt  +downstreamnt
atgaataatactcaatcagcagcaatgccacttgttgaaaatgaagaagttaatctttta
gattcgattgttgaacaaagccgtattgcacgaaatgaagaagaacattctcgtgctaaa
agcttaattggtgagcttgctaaagaagtaatggcagggaccattactgtttctgaaaat
atgactttatcaattgataagcgtattgcagaaattgatgctctgatttcaaagcagtta
agtcagatcatgcacaatgaacaattccaaaaaattgagtcaacttggcgtggtctttat
tacttttgtcaggaaacgccttcaaatccgctcattaaaattcgtatgcttaatacgact
aagaaagagttggtaaaagatttccaaggtgctacagactttgatcaaagcactttgttt
aagaaaatctacgaagaagaatacggttcttttggtggtgcaccatactcagcattaatt
ggtgattttgagtttgatcgtactccatctgatatgtatttgcttgagcaaatctctcat
gttgcagcggcagcacatgcaccatttatttcagctgctagtccgagcattttaggcctt
gaatcatttacagatattgatcgtcctagagatgtttcaaaaatctttgaaaccgctgaa
tatgttcaatggcgttcgttccgtgatagtgaagactcacgttatgttgcattgactttg
cctcatgtcttgggtcgtctcccatatcatccaaaagaaggtactgcgacagaaggcttt
aattttattgaagatgtttctggtgaaaaccacaatgaatatttgtggatgaatgcagct
tatgcttttggtactcgcttaacaaatgcatttgatatgcatggttggtgtgctgctatt
cgcggtgttgaaggtggtggtttagttgaaggcttgccagtacatacttttaaaacacaa
gatggcgaagtggtattcaagtgtccaactgaaattgcaatcacggatcgccgtgaaaaa
gagttaagcgatctaggcttcattccgttagtacattgtaaaaatacagattacgcagct
ttctttggcgcgcaatcaactcaaaaacctaaaaaatatgacaatgatacagccaatgca
aactcggctttatcaagtcagattcagtacatcatggctgtttcacgtattgcacattac
ttaaaagcaatgatgcgagataaagtgggtagctttgcttctgctggaaatgttgaagca
ttcttaaatgagtggttgtcacagtatgtcttacttgacgatggtgcttctcaagaagca
aaagctcaatacccgttacgtgaagcgtctgtaaaagttgtagaagatcctgctcaacca
ggtcactacaaatctgtggttttcttgcgaccacatttccagctggatgagttgtcggtt
tctttacgacttgtcactgagttacctcagtcctcaaattaa

DBGET integrated database retrieval system