KEGG   Acinetobacter baumannii BJAB0868: BJAB0868_01418
Entry
BJAB0868_01418    CDS       T02728                                 

Definition
(GenBank) Outer membrane protein-related peptidoglycan-associated (lipo)protein
  KO
K03286  OmpA-OmpF porin, OOP family
Organism
abaj  Acinetobacter baumannii BJAB0868
Brite
KEGG Orthology (KO) [BR:abaj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:abaj02000]
    BJAB0868_01418
Transporters [BR:abaj02000]
 Other transporters
  Pores ion channels [TC:1]
   BJAB0868_01418
SSDB
Motif
Pfam: OmpA BON PTE HTH_45
Other DBs
NCBI-ProteinID: AGQ09967
Position
1503129..1503896
AA seq 255 aa
MNQKYQIKLSQLIKGCFIYAIANYALAQPIVVEGVVPNEASKQAILMKMQSVYGADQVVD
KIQVRPVAAPNGWSDSVTRVITPDLKKVSQGKLSVNGTRFELTGKMLNPTEIQPTIQSFQ
SLVQPPYQLFSQLSVNQAEQKIIDDALKNRIIEFESGSAVLTEAGQKILDEMAVALNKVG
GKKVKIVGHTDSSGDATKNLKLSQDRALAVKNYLISKNIPADHLSTEGLGSSKPVADNTS
AEGRKKNRRIEFTVL
NT seq 768 nt   +upstreamnt  +downstreamnt
atgaatcaaaaatatcaaattaaactttcacaacttataaaaggctgttttatatatgca
attgcgaattatgctttagcacagcctatagttgtagaaggtgtagtgccaaatgaagca
agtaaacaggctattttaatgaaaatgcagtctgtttatggtgcagatcaggttgtcgat
aaaatacaagttcgaccagttgccgctccaaatggatggagtgactctgtcacacgagtg
attacacctgatcttaaaaaagtttctcagggtaagttaagtgttaatggaacccgattt
gaactgaccgggaaaatgctaaatccgacagaaatacagccaaccattcagtcttttcag
agtttggtacagcctccatatcaattattttcccagctttctgtaaatcaggctgagcag
aagattattgatgatgctttaaaaaatcgaattattgaatttgaatctggtagtgcagta
ttaactgaagctgggcaaaaaattcttgatgaaatggctgtggctttaaataaagtgggc
gggaaaaaagtcaaaattgtggggcataccgatagttctggtgatgcgaccaaaaactta
aaactcagccaagatcgagctttagcagttaaaaattatttaattagtaagaatattcct
gctgatcatttatctaccgaaggtttaggttcatctaagcctgtagcggacaatacttct
gcggaaggtaggaagaaaaaccgccgaattgagttcaccgttttatag

DBGET integrated database retrieval system