KEGG   Acinetobacter baumannii BJAB0868: BJAB0868_01421Help
Entry
BJAB0868_01421    CDS       T02728                                 

Definition
(GenBank) hypothetical protein
  KO
K11902  type VI secretion system protein ImpA
Organism
abaj  Acinetobacter baumannii BJAB0868
Brite
KEGG Orthology (KO) [BR:abaj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:abaj02044]
    BJAB0868_01421
Secretion system [BR:abaj02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BJAB0868_01421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImpA_N
Motif
Other DBs
NCBI-ProteinID: AGQ09970
Position
1507101..1508195
Genome map
AA seq 364 aa AA seqDB search
MSIDISELLKPINDSLLCGEDYSFSNEFHEIKKARTQDDLLLDQGDWVAERKQADWDFVA
KSVSTLLIEKTKDIRLLTWVIEAWTHLNGFEGMVKGITLTHTMLNQYWQDIHPIIEDDDL
DQRIGLLQGLINQLPMLLKKVPLTNTAPYYNLLDYDNFLYHENIRRKQTEEYESQSGPSE
LEQFDQAIFNTSKTFQYSNYQEFNSVLTEWNVLKQTLDHLMGLDSPSFAAIDSAFETIHS
TLRKIYKAEAFGTGLAPSQEQAAVITTPSMENQVPVQIVSDQPMFQPQAQTHLANREQAM
KVLQEIADYFQANEPHSPVSYMLQKTIKWSQMPLHEWLAQVIKDEHPLQMVQEMLGVQPK
NEYE
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgagtattgatatttctgaactacttaaacccattaatgacagcttgctttgtggtgag
gattattcattttctaatgaatttcacgagataaagaaagccagaacacaggatgatcta
ttattagatcagggggattgggttgctgaacggaagcaggcagattgggactttgttgcg
aagagtgtaagcactttgctcattgaaaaaaccaaagatatccgtctattaacttgggta
atagaagcctggactcatctaaatggttttgaaggcatggtaaagggaatcactttaact
cataccatgctgaaccaatattggcaggatattcatccgattattgaagatgatgatttg
gatcagcgtattggtttattacaaggtcttattaatcagttgccaatgctgttgaagaaa
gtacctttaaccaatacagctccttattataacttgcttgattacgataattttctatat
cacgaaaatatacgccgtaagcaaacagaagagtacgagagtcagtcaggtccatctgaa
ttagaacaatttgatcaagcgatctttaatacctctaaaacctttcaatactcaaattat
caagagtttaattcggttttaacggagtggaatgttttaaaacagacactcgaccattta
atgggattagattcaccgagttttgctgcaattgattctgcatttgaaacaatacacagc
actttacgtaaaatttacaaagcagaggcttttggtactgggcttgcgccgagccaagaa
caggccgctgtcatcacgacaccgtctatggaaaatcaagtgcctgtacaaatcgtatca
gaccagcctatgtttcagccacaagcacaaactcacttggccaatcgcgagcaagcaatg
aaagtgctgcaagaaatagctgattattttcaagcaaatgagccacatagtcctgtgagc
tatatgctccaaaagaccattaaatggagccaaatgccgctgcatgaatggttagcacaa
gtgattaaagatgagcatccattgcaaatggttcaggaaatgttaggtgttcaacctaaa
aatgaatatgaataa

DBGET integrated database retrieval system