KEGG   Acinetobacter baumannii BJAB0868: BJAB0868_01750Help
Entry
BJAB0868_01750    CDS       T02728                                 

Definition
(GenBank) Malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
abaj  Acinetobacter baumannii BJAB0868
Pathway
abaj00620  Pyruvate metabolism
abaj00630  Glyoxylate and dicarboxylate metabolism
abaj01100  Metabolic pathways
abaj01110  Biosynthesis of secondary metabolites
abaj01120  Microbial metabolism in diverse environments
abaj01200  Carbon metabolism
Module
abaj_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:abaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BJAB0868_01750
   00630 Glyoxylate and dicarboxylate metabolism
    BJAB0868_01750
Enzymes [BR:abaj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BJAB0868_01750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: AGQ10299
Position
1831612..1833777
Genome map
AA seq 721 aa AA seqDB search
MTARIQKGKLAIAKELYDFIENEALPGSGLDSETYWKNFEQVVVDLSPKNKALLAKRDEL
QAKIDEWHRNNKFELGAYKAFLTEIGYLLPEVEDFQITTENVDEEIALLAGPQLVVPVRN
ARYCLNAANARWGSLYDALYGFDVISEEGGAEKGKGYNPVRGAKVIEFAKNFLNEIFPLA
QGSHADATKYAIEQNKLVVTLKDGTKTGLAHEAQFVGFNGEEANPSEVVLLSNGLHVIIE
IDANSPIGQTDLAGVKDLTLEAAVTTIQDLEDSVAAVDAEEKVEGYRNWLGLMKGTLQES
IEKNGKTIVRALNKDREIKNLIGGTTKLHGRSLMLLRNVGHLMTNPAILVDGEEIFEGIM
DALVTPLLSIADIRSENENKNSRKGSMYIVKPKMHGPEEVAFAVELFERAEQALGLPAKS
LKIGIMDEERRTSVNLKNCIAAAKDRTIFINTGFMDRTGDEIHTSMEAAPVVRKEAVKTQ
KWIAAYENRNVAIGLKCGLQGKAQIGKGMWPKPDSMKDMLATKAAHPNAGASCAWVPSPT
GAVLHAMHYHQVNVKARQDQLKAEEMLSLDDLLTPPFATDTNWSAEEINNELENNCQGIL
GYVVRWVDLGVGCSKVPDINNVGLMEDRATLRISSQHVANWLRHGIVTREQVEEVLKRMA
KIVDEQNANDPLYKPMAANFETNIAFQAASDLIFKGCEQPSGYTEPLLHAARLKLKGYTG
D
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgactgcacgtattcaaaaaggcaagttagcgattgctaaagaactttacgattttatc
gaaaatgaagctttaccaggttctggtttagatagtgaaacttactggaagaactttgag
caagttgttgtcgaccttagtccaaagaataaagcattattggctaagcgtgatgaatta
caagcaaaaattgatgaatggcaccgcaacaataaatttgaattaggtgcttacaaagca
tttttaactgaaattggttatttattaccagaagttgaagacttccaaattactactgaa
aacgtagatgaagaaattgcattgttagcaggcccacaattagtagtacctgtacgtaat
gcacgttattgcttaaatgcagcaaatgcgcgctggggttctttatatgatgcactttac
ggttttgatgtaatttcagaagaaggtggtgcagaaaaaggaaaaggatataaccctgta
cgtggtgcgaaagttattgagtttgctaaaaacttcttaaatgaaattttcccgcttgcg
caaggctcacatgctgatgcaactaaatatgcaatcgagcagaataaactcgttgtgact
ttaaaagatggtactaaaactggcttagctcatgaagctcagtttgtgggtttcaatggt
gaagaagcgaacccttcagaagttgttcttttgagtaatggcctacatgtcattattgaa
attgatgcgaatagcccaattggccaaactgatttagcgggtgttaaagatctaacactt
gaagctgcggttacaacaattcaggatcttgaagactctgtagcagctgttgatgcagaa
gaaaaggttgaaggttatcgtaactggttaggtttgatgaagggcactcttcaagaatct
atcgaaaaaaatggtaaaacaattgttcgcgctttgaacaaagaccgtgaaattaaaaat
ttgatcggtggcacaacaaaacttcatggtcgttcacttatgttacttcgtaacgtaggt
catttaatgacgaatccagcaattttagttgatggcgaagaaattttcgaaggtattatg
gatgcgttggtaacaccattgttgtcaattgctgacatccgtagtgaaaacgaaaataaa
aactctcgtaaagggtctatgtatattgttaaaccaaaaatgcatggtcctgaagaagtt
gcttttgctgttgagttatttgagcgtgctgagcaagccctaggattaccagcgaagtct
ttaaaaatcggtattatggatgaagaacgccgtacatctgtaaacctgaaaaactgtatt
gctgctgctaaagatcgcacaatctttattaacactgggttcatggaccgtacgggtgac
gaaatccatacctctatggaagctgcaccagttgttcgtaaagaagctgttaaaacacaa
aaatggattgctgcttacgaaaatcgtaacgttgcaatcggtttgaaatgtggtttacaa
ggtaaagcacagattggtaaaggcatgtggccaaaaccagatagcatgaaagatatgttg
gcaactaaagctgctcatccaaatgctggtgcttcatgtgcttgggttccatcaccaact
ggtgctgtacttcatgcgatgcattaccaccaagtaaatgtaaaagcacgtcaagatcag
ttaaaagctgaagaaatgttgtcattagatgacttgttaactcctccatttgcaactgat
acaaactggtcagcagaagaaattaataacgaacttgaaaataactgccaaggtatttta
ggttacgttgttcgttgggtggacttaggtgtaggttgttcaaaagttccggatattaac
aatgtgggcttaatggaagaccgtgcaacattacgtatttcttctcaacatgttgccaac
tggttacgtcacggtatcgtgactcgtgaacaagttgaagaagtgcttaaacgcatggca
aaaattgttgatgaacaaaatgcgaatgatccattgtataaaccaatggcagctaacttt
gaaactaatattgctttccaagcagcttcagatcttatctttaaaggttgtgaacagcct
tctggttatactgagccattactacatgcggctcgtttaaaattaaaaggttatacaggt
gactaa

DBGET integrated database retrieval system