KEGG   Acinetobacter baumannii BJAB0868: BJAB0868_01863Help
Entry
BJAB0868_01863    CDS       T02728                                 

Definition
(GenBank) Threonine dehydrogenase-related Zn-dependent dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
abaj  Acinetobacter baumannii BJAB0868
Pathway
abaj00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:abaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BJAB0868_01863
Enzymes [BR:abaj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BJAB0868_01863
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BJAB0868_01863
    1.1.1.-  
     BJAB0868_01863
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 Semialdhyde_dh FAD_binding_3 2-Hacid_dh_C TrkA_N
Motif
Other DBs
NCBI-ProteinID: AGQ10412
Position
1949551..1950609
Genome map
AA seq 352 aa AA seqDB search
MKAARFYDRGDIRIEDIPEPEVTPGTVGIKVAWCGICGTDLHEFMEGPIFIPPCGHPHPI
SGESAPITMGHEFSGVVYAVGEGVDDIEIGQHVVVEPYIVADDVPTGPGDNYHLSKNMNF
IGLGGRGGGLSEKIAVKRRWVHPISNKIPLDQAALIEPLSVGHHAFVRSGAKAGDIALVG
GAGPIGLLLSAILKAKGLKVIITELSAKRKEKAKESGVADYILDPSEVDVVSEVMKITNG
DGVDVAFECSSVNKVLDTLVAAVKPTGVIVIVSIWSHPASINVHSVVMKELDVRGTIAYV
NDHQETIKLVEEGKINLEPFITQRIQLDDLISQGFETLIHNNESAVKIIVHP
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcgcgtttttatgacagaggtgatattcgtattgaagatatccctgaacca
gaagtcactcccggcactgtaggcattaaggtagcttggtgtggaatctgtggtacagat
ttgcacgaatttatggaaggaccaatttttattccaccgtgtggacatccgcatcctatt
tcaggcgaatctgcgccgattactatgggacatgagttttcaggtgtggtttatgccgta
ggtgaaggtgtcgatgatattgaaattggtcagcatgtagtcgtagagccttatattgtg
gctgatgatgtgccgactggaccgggcgataattatcatctttccaaaaatatgaacttt
attggtttaggcggtcgtggcggtggcttatcggagaaaattgcggttaaacgccgttgg
gtgcatccaatttccaataaaattccattagatcaagcggccttaattgaaccgttatcg
gtgggtcatcatgctttcgtacgtagtggtgcaaaggccggtgatattgcactggttggc
ggtgcggggccaattggtttattgctttcggcaattttaaaagcgaaagggcttaaggtc
atcattaccgaactaagtgccaaacgtaaagaaaaagccaaagagtcgggagttgcagat
tatattttagacccgtcagaagttgatgttgtttctgaggtcatgaaaattactaatggc
gatggtgttgatgttgcgtttgaatgtagtagcgttaacaaggtgttagatactttggtc
gcggcagtgaaaccaacaggcgttatagttattgtttcgatttggagccacccagcatca
attaatgtgcacagtgtggtaatgaaagagcttgatgtacgcggcacaattgcctatgta
aatgaccatcaggagactattaaactggttgaagaaggtaaaataaatcttgaacctttt
attacgcagcgcattcaacttgatgatttgatttcacaaggttttgaaaccttaattcat
aacaatgagtcagccgttaagattattgtacatccataa

DBGET integrated database retrieval system