KEGG   Acinetobacter baumannii BJAB0868: BJAB0868_02429Help
Entry
BJAB0868_02429    CDS       T02728                                 

Definition
(GenBank) AICAR transformylase/IMP cyclohydrolase PurH (only IMP cyclohydrolase domain in Aful)
  KO
K00602  phosphoribosylaminoimidazolecarboxamide formyltransferase / IMP cyclohydrolase [EC:2.1.2.3 3.5.4.10]
Organism
abaj  Acinetobacter baumannii BJAB0868
Pathway
abaj00230  Purine metabolism
abaj00670  One carbon pool by folate
abaj01100  Metabolic pathways
abaj01110  Biosynthesis of secondary metabolites
abaj01130  Biosynthesis of antibiotics
Module
abaj_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:abaj00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BJAB0868_02429
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    BJAB0868_02429
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:abaj04147]
    BJAB0868_02429
Enzymes [BR:abaj01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.3  phosphoribosylaminoimidazolecarboxamide formyltransferase
     BJAB0868_02429
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.10  IMP cyclohydrolase
     BJAB0868_02429
Exosome [BR:abaj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BJAB0868_02429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AICARFT_IMPCHas MGS HisG_C
Motif
Other DBs
NCBI-ProteinID: AGQ10978
Position
2548806..2550380
Genome map
AA seq 524 aa AA seqDB search
MTIKRALISVSDKTGIVEFAQNLAALGVELLSTGGTYKLLKDNNIAVVEVSEHTGFPEMM
DGRVKTLHPKIHGGILARRGLDEAVMQEHNIDPIDLVVVNLYPFAATVAKPNCSLADAIE
NIDIGGPTMVRAAAKNHASVGIVVNASDYDTVISELKASGSLSYETRFDLAVKAFEHTAQ
YDGMIASYLGARVGKAEGEADLFPRTFNTQLNKAQDLRYGENPHQSAAFYVEANAKEASV
STAKQLQGKELSYNNIADTDAALECVKSFAKPACVIVKHANPCGVAVSLDGIKAAYDLAY
ATDPESAFGGIIAFNRELDVATAQAIVDRQFVEVIIAPSIADGVLEVTGAKKNVRVLVCG
ELPAIDARAPQLDYKRVNGGLLVQDQDLGMITKDDLKVVTKRAPTEQEIDDLIFAWKVAK
YVKSNAIVYAKNRQTIGVGAGQMSRVNSARIAAIKAEHAGLVVEGAVMASDAFFPFRDGI
DNAAKAGIKCIIQPGGSMRDEEVIAAADEAGIAMVFTGMRHFRH
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgactattaaacgtgctttgatttctgtatcagacaaaacaggaattgtcgaatttgct
caaaaccttgcagctttaggggtagaattattatctacaggcggcacatacaagttgctt
aaagataataatattgctgttgttgaagtatctgaacataccggtttcccggaaatgatg
gatggccgtgttaaaacactacatccaaaaattcatggcggtattttggctcgtcgtggt
ctagacgaagctgttatgcaagaacacaacatcgatccaatcgatttagttgtcgttaac
ctttacccatttgcggctacagtagctaaacctaactgttctcttgctgatgctatcgaa
aatatcgacatcggtggtccaacaatggtacgtgctgctgctaagaaccatgcatctgtc
ggtattgtggtaaatgcttcagattacgatacagttattagcgaattaaaagcttctggt
tcactttcttacgaaacacgcttcgatttagcggttaaagcatttgaacatacagctcaa
tatgacggcatgattgcttcttacttaggcgctcgcgttggtaaggccgaaggtgaagca
gatttattccctcgtacgttcaacacccaattaaacaaagcacaagatttacgttacggc
gaaaatccacaccaatctgctgctttctatgttgaagcaaatgcaaaagaagcttctgtt
tctactgcaaaacaattacaaggcaaagaattgtcttataacaacattgctgatactgat
gctgcccttgagtgcgtgaaatcatttgcaaaaccagcttgtgtcatcgtaaaacatgct
aacccttgtggtgttgccgtttctttagacggtattaaagctgcttatgatttagcttac
gcaacagatccagaatctgctttcggcggtattattgcatttaaccgtgagttagatgtt
gctactgctcaagcaattgtagatcgccaattcgttgaagtaattattgctccaagtatt
gctgatggtgtacttgaagttactggcgcgaagaaaaatgttcgtgttttagtatgtggt
gaattacctgcaattgatgcacgtgctccacaacttgactataaacgcgttaacggcggc
ttacttgttcaagaccaagacttgggcatgatcaccaaagatgatcttaaagttgtgact
aaacgtgcaccaacagaacaagaaattgatgaccttattttcgcatggaaagttgcgaaa
tacgtaaaatcaaacgctattgtttatgccaaaaaccgtcaaactattggtgtaggtgct
ggccaaatgagccgtgttaactcagcacgtatcgcagcaattaaagctgagcatgctggt
ctggttgttgaaggcgcagttatggcatctgatgcattcttcccgttccgtgacggtatt
gataatgcagcgaaagctggcattaaatgcattattcaaccgggtggttctatgcgtgat
gaagaagttattgcagctgctgatgaagctggaattgcaatggtcttcactggtatgcgc
catttccgccactaa

DBGET integrated database retrieval system