KEGG   Acinetobacter baumannii BJAB0868: BJAB0868_03147Help
Entry
BJAB0868_03147    CDS       T02728                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
abaj  Acinetobacter baumannii BJAB0868
Pathway
abaj00071  Fatty acid degradation
abaj00072  Synthesis and degradation of ketone bodies
abaj00280  Valine, leucine and isoleucine degradation
abaj00310  Lysine degradation
abaj00362  Benzoate degradation
abaj00380  Tryptophan metabolism
abaj00620  Pyruvate metabolism
abaj00630  Glyoxylate and dicarboxylate metabolism
abaj00640  Propanoate metabolism
abaj00650  Butanoate metabolism
abaj00900  Terpenoid backbone biosynthesis
abaj01100  Metabolic pathways
abaj01110  Biosynthesis of secondary metabolites
abaj01120  Microbial metabolism in diverse environments
abaj01130  Biosynthesis of antibiotics
abaj01200  Carbon metabolism
abaj01212  Fatty acid metabolism
abaj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:abaj00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BJAB0868_03147
   00630 Glyoxylate and dicarboxylate metabolism
    BJAB0868_03147
   00640 Propanoate metabolism
    BJAB0868_03147
   00650 Butanoate metabolism
    BJAB0868_03147
  Lipid metabolism
   00071 Fatty acid degradation
    BJAB0868_03147
   00072 Synthesis and degradation of ketone bodies
    BJAB0868_03147
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BJAB0868_03147
   00310 Lysine degradation
    BJAB0868_03147
   00380 Tryptophan metabolism
    BJAB0868_03147
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BJAB0868_03147
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BJAB0868_03147
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BJAB0868_03147
Enzymes [BR:abaj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BJAB0868_03147
Exosome [BR:abaj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BJAB0868_03147
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ketoacyl-synt Dodecin
Motif
Other DBs
NCBI-ProteinID: AGQ11696
Position
3324045..3325250
Genome map
AA seq 401 aa AA seqDB search
MSEAYIIDAIRTPRGKGKKDGSLYEVKPITLLTTLLNELQQRHQLDTTKVDDIVLGCVTP
IGDQGGDIAKTAAIAAGWNDDVAGVQINRFCASGLEAVNMAAMKVRSGWEDLVVAGGVES
MSRIPMGSDGGPWALDPETNLKSSFVPQGVGADLIATLDGYSREDVDNFAVKSQQKAAAA
QANGYFDQSVVPVKDHAGIVILEKDEFIKGNTTLEGLAKLNPSFEMMGQMGFDAVALQKY
PEAQKVNHVHHAGNSSGIVDGAALVLLASEKAVKEQNLKPRAKVLATALVGTDPTIMLTG
PAPAARKALEKAGLTIDDIDLFEVNEAFAAVVMRFINELNVPAEKVNVNGGAIALGHPLG
ATGAMILGTLLDELERQNKKRGLATLCVGGGMGIATIIERV
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaggcttatattattgacgccattcgcacaccacgcggaaaaggaaaaaaagac
ggctctctttacgaagtaaaaccaatcacattactcaccactctattaaacgaattacag
caacgccatcaactcgatacaactaaagtagatgatattgttctgggctgcgtgacacca
attggtgatcagggcggtgatattgccaaaacagcagcgattgcagcgggctggaatgat
gatgttgcaggtgtgcaaattaaccgcttttgtgcttcaggtttagaagcggtcaacatg
gcagccatgaaagttcgttctggttgggaagatttagtggttgctggtggcgttgaatca
atgtcacgtatcccaatgggttctgatggcggaccgtgggcgttagatccggaaaccaac
cttaaatcatcttttgttccacaaggtgtcggcgctgacctcattgcaaccttagatggc
tatagccgagaagatgttgataattttgccgtaaagtcacaacaaaaagcagcggcagct
caagcaaatggttatttcgatcaatcagttgtgccagtcaaagatcacgcaggtattgtg
attttagaaaaagatgaatttattaaaggcaataccacacttgaagggttagcaaagctc
aacccaagttttgaaatgatgggacaaatgggctttgatgctgttgccctgcaaaaatat
ccagaagcacaaaaagtaaatcatgttcatcatgctggtaactcatcaggtattgtcgat
ggagcagctcttgttttactggcttcagaaaaagcagtgaaagaacaaaacttaaaacca
cgcgctaaagttttggcaactgccctagtcggtactgatccaaccattatgctgactggc
cctgcgcctgctgcacgcaaagccttggaaaaagctggtttaacaattgatgatattgac
ctatttgaagtcaacgaagcatttgcagctgtcgtaatgcgttttataaatgaactcaat
gtgcctgctgaaaaagtcaacgtaaatggcggtgcgattgctttaggtcatcccttaggg
gcaactggtgccatgattttgggtacattacttgatgagcttgaacgtcaaaataaaaaa
cgcggtttagcaacgctctgtgtcggcggtggtatgggtattgccaccattattgaacgt
gtataa

DBGET integrated database retrieval system