KEGG   Acinetobacter baumannii LAC-4: ABLAC_05780Help
Entry
ABLAC_05780       CDS       T03519                                 

Definition
(GenBank) [glutamate--ammonia-ligase] adenylyltransferase
  KO
K00982  [glutamine synthetase] adenylyltransferase / [glutamine synthetase]-adenylyl-L-tyrosine phosphorylase [EC:2.7.7.42 2.7.7.89]
Organism
abal  Acinetobacter baumannii LAC-4
Brite
KEGG Orthology (KO) [BR:abal00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ABLAC_05780
Enzymes [BR:abal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.42  [glutamine synthetase] adenylyltransferase
     ABLAC_05780
    2.7.7.89  [glutamine synthetase]-adenylyl-L-tyrosine phosphorylase
     ABLAC_05780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GlnE GlnD_UR_UTase
Motif
Other DBs
NCBI-ProteinID: AIY35933
Position
600777..603527
Genome map
AA seq 916 aa AA seqDB search
MNAEQLQKTLRASQYAEQVLGLHQAVLEQDYQIDQFAAPLSTEQIYQLVDITLDGIGDEI
TWMRALRILRSRLMFRWIWQDANQLTDVVTLTRELSDFADASICAAKAFARVALVAKHGE
PLSYSGKVQDLIVVAMGKLGAQELNLSSDIDLIFAFDEQGETNGRKCIDVQQFCILWGQK
LIYLLEHITADGFVFRVDMRLRPWGDGSALAISHAALEKYLSQHGREWERYAWIKARVVT
GGKEGQDLLEMTRPFVFRRYVDYTAFAAMRDMKAMIEREVLRRHIEDDIKLGAGGIREIE
FIVQVFQLIYGGSKRELQDRQCLVSLEHIGEAGLLEKQAVLELEDAYLFLRRVEHAIQAL
NDQQTQLLPEEADLRQRIIDTLGFTSWNEFIDVLNEKRQKVKVQFKQLIEDTSSNAATEN
FGQLEQQLDEVLDDNAKNLIHEFWHGHALKKLPSNAVQRLKTFWPHLIEAILQSEQPQTA
LLRLMPLIESVMRRTVYLVMLIESKGALQRLVKMATVSPWICEELTQYPVLLDEFLSMDF
ELPKRKDLEDSLRQQLLRIEIDQVEDQMRVLRLFKKSNVLTVAASDVLAESPLMKVSDAL
TDIAEVSVNATLNLAYQTVAKRHGYPKDIEGKRCSLDYKAFAVIGYGKVGGIELGYGSDL
DLVFIHYLDEQADTDGTKSITGFEFAMRVAQKFMSLMTTQTLDGRVYEIDTRLRPSGEAG
LLVTSLKAYEHYQLKSAWLWEHQALVRARSIAGDEALCQKFEIFRREILTQSRDEAYVRE
EVLKMRQKMKDHLGSSSEQKKHGIFHLKQDAGGIVDIEFMAQYAVLAWSGTKPDLAHYSD
NVRILEDAAKADCLSSEDATALIRAYLSERAESHRLALANQSMQVSAADWRSTRAVVCNL
WQRLIDPTASVELDSE
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcggagcagttacaaaaaacattgcgtgccagccaatatgctgaacaagtttta
ggattacatcaggctgttttagaacaagattatcaaatagatcaatttgctgcaccgctc
tcaacagaacaaatttaccaacttgtagacatcacgcttgatggaattggcgatgaaata
acttggatgcgtgcgcttcgtatactgcgcagtcgtttaatgtttcgctggatctggcaa
gatgccaatcaactgacggatgtcgttacacttactcgtgaactttcagactttgccgat
gcaagtatttgtgccgcaaaggcttttgctcgtgttgcattggttgctaaacacggcgaa
ccattaagttattcaggcaaagttcaagatttgattgtggttgccatgggtaagcttggg
gcacaggaattaaatctatcaagtgatatcgacctgatttttgcctttgatgagcaaggc
gaaaccaacggtcgtaaatgtattgatgtacagcagttctgtattttgtggggacaaaaa
cttatttatttacttgaacatatcaccgcagatggttttgtgtttcgagtagacatgcgc
ttacggccttggggagatggctctgcattggcgattagtcatgcagctttagaaaaatat
ttaagtcagcatggccgtgaatgggaacgttacgcatggattaaggcacgtgtagtcact
gggggtaaagaagggcaagacttattagaaatgacacgtccttttgtattccgtcgttat
gtcgattacaccgcttttgctgccatgcgcgatatgaaagcgatgattgagcgcgaagta
ttacgtcggcatattgaagatgacattaagctcggggcaggcggtatacgcgaaattgag
tttattgttcaggtgttccagcttatttacggcggttctaaacgtgagctacaagatcgt
caatgtttggtcagtcttgagcatattggtgaggcaggcttgttagaaaaacaggccgta
ctagagcttgaagatgcttacctgtttttgcgccgtgttgaacatgcaattcaagccttg
aatgatcagcaaacgcaactattaccagaagaagcagatttacgacaacgcattatagat
accttgggttttacgagttggaatgaatttattgatgttcttaacgagaaacgccaaaaa
gtaaaagtccagtttaagcagctcattgaagacacaagttccaatgcagctaccgagaac
tttggacagttagagcagcagctagatgaagtgttagatgataatgcaaaaaatctaatt
catgagttctggcatggtcatgcacttaaaaaacttccttccaatgcggtgcagcgttta
aaaacgttttggccccatttaattgaagccattttacagtctgaacaaccacaaactgca
ttattacgtttaatgccactgattgaatcagtcatgcgtcgaaccgtctatttggtaatg
ctgattgaaagtaaaggggcattacaacgcttagtaaaaatggcgacagtgagcccgtgg
atttgtgaagagttaacgcaatatccggtattgctggatgagttcttgtcgatggacttt
gaattaccaaaacgtaaggacttggaagactcattacgtcagcaattacttcgtatcgaa
attgatcaggttgaagatcaaatgcgggtacttcgcctgtttaaaaagagtaatgtgtta
acggttgctgcaagtgatgtgttagctgaaagccctcttatgaaggtatctgatgctttg
acagatattgcagaagtcagtgttaatgcaactcttaatttagcttatcagaccgtagca
aagcgtcatggttacccaaaagatatcgagggaaaacgttgttcactcgattataaagct
tttgctgtcattggttatggcaaggtgggtggcattgaactgggctatggttcggactta
gatctagtctttattcactatctagatgaacaagccgacacggatggtactaagtcaata
actggttttgagtttgctatgcgtgtcgctcaaaagtttatgtctttaatgaccactcaa
acgcttgatggccgcgtttatgaaattgatacacgtttaagaccttcaggtgaggctggt
ttattagtgacaagcctgaaagcctatgagcattatcagttgaaaagtgcatggctttgg
gagcatcaggcattagttcgtgcccgttctattgcaggtgatgaagcgctttgccaaaaa
tttgaaatatttcgccgcgagatattgactcaatctagagatgaggcttatgttcgtgag
gaagtgctgaaaatgcgtcagaaaatgaaagaccacttaggttcatcttctgaacaaaaa
aaacatggtatttttcatttaaaacaggacgcaggtggtatcgtagatatcgaatttatg
gcacagtatgctgtacttgcatggagcgggacgaaacccgatctcgcccattattctgat
aatgtaagaatattagaagatgctgctaaagcagactgcttatccagtgaagatgccaca
gcattaattcgagcctatcttagtgaacgtgccgaaagccaccgcttagcccttgcgaat
caatccatgcaagtaagcgcagcggactggcgtagtacccgtgcggtcgtttgcaattta
tggcaaagattaatagacccaaccgcctcggttgagttggatagtgaatga

DBGET integrated database retrieval system