KEGG   Acinetobacter baumannii LAC-4: ABLAC_07900Help
Entry
ABLAC_07900       CDS       T03519                                 

Definition
(GenBank) pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
abal  Acinetobacter baumannii LAC-4
Pathway
abal00020  Citrate cycle (TCA cycle)
abal00310  Lysine degradation
abal00380  Tryptophan metabolism
abal01100  Metabolic pathways
abal01110  Biosynthesis of secondary metabolites
abal01120  Microbial metabolism in diverse environments
abal01130  Biosynthesis of antibiotics
abal01200  Carbon metabolism
Module
abal_M00009  Citrate cycle (TCA cycle, Krebs cycle)
abal_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:abal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ABLAC_07900
  09105 Amino acid metabolism
   00310 Lysine degradation
    ABLAC_07900
   00380 Tryptophan metabolism
    ABLAC_07900
Enzymes [BR:abal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     ABLAC_07900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding DUF5304 GCV_H OmpA
Motif
Other DBs
NCBI-ProteinID: AIY36145
Position
829971..831167
Genome map
AA seq 398 aa AA seqDB search
MATEIKAPVFPESVADGTIATWHKKVGEPVSRDEVICDIETDKVVLEVVAPADGSLVAII
KGEGDTVLSDEVIAQFEAGAGAAAAAPAAVEQAVAQTQAGAAPVVERNETVSDQAPAVRK
ALTESGIAASDVQGTGRGGRITKEDVANHQAKPAANVTPLSVAVGERIEKRVPMTRLRKR
VAERLLAATQETAMLTTFNEVNMKPIMELRKQYKDAFEKRHGARLGFMSFFVKAATEALK
RYPAVNASIDGDDIVYHGYYDIGVAVSSDRGLVVPVLRDTDRMSYAEVEAGIAAYAAKAR
DGKLSIEEMTGGTFTITNGGTFGSLLSTPILNQPQTGILGMHKIQERPMAVNGQVEILPM
MYLALSYDHRMIDGKEAVGFLVAIKELLEEPAKLILDL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccgaaattaaagcaccggtattcccagagtctgttgcagatggaaccatcgca
acttggcataaaaaggtgggtgaacctgtatcacgtgatgaagtaatctgtgatattgaa
accgacaaagttgttttagaagttgttgctcctgcagatggtagcttggttgcaatcatt
aaaggtgaaggcgatacagttctttctgacgaagttattgctcaattcgaagctggtgct
ggcgcagcggctgctgctcctgcggcagtagaacaagcagttgctcagactcaagctggt
gctgctcctgttgttgagcgtaatgaaactgtatctgatcaagctcctgcggtacgtaaa
gcgttaactgaatctggtattgctgcttctgacgtacaaggtactggtcgtggtggtcgt
atcactaaagaagatgttgcaaaccatcaagctaaaccagctgctaacgttactccatta
agcgttgctgttggcgagcgtatcgaaaaacgcgttccaatgactcgtttacgtaaacgt
gtagctgagcgtcttcttgcagctactcaagaaacagcaatgttaactacatttaacgaa
gttaacatgaagccaatcatggaattacgtaagcaatataaagatgctttcgaaaaacgt
catggtgctcgtttaggcttcatgtcattcttcgttaaagcagcaactgaagcgcttaaa
cgctacccagctgtaaatgcttcaattgatggtgatgatattgtttatcacggttactat
gacatcggtgttgcagtatcttctgatcgtggtcttgttgtaccagtattacgtgatact
gaccgtatgagctatgcagaagttgaagcaggtattgctgcttatgctgctaaagcacgt
gatggtaaactatctatcgaagaaatgactggcggtactttcacaatcactaacggtggt
acttttggttcattactttcaactccaattttgaaccagccgcaaactggtatcttgggt
atgcataaaatccaagaacgtcctatggcggtaaatggtcaagttgaaatcttgccaatg
atgtacttagcgctttcttatgaccaccgtatgatcgatggtaaagaagctgtaggtttc
ttagtagcaatcaaagaattgttagaagaaccagctaaactcattcttgatctttaa

DBGET integrated database retrieval system