KEGG   Acinetobacter baumannii LAC-4: ABLAC_08220Help
Entry
ABLAC_08220       CDS       T03519                                 

Definition
(GenBank) alkaline phosphatase D family protein
  KO
K01113  alkaline phosphatase D [EC:3.1.3.1]
Organism
abal  Acinetobacter baumannii LAC-4
Pathway
abal00790  Folate biosynthesis
abal01100  Metabolic pathways
abal02020  Two-component system
Module
abal_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:abal00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ABLAC_08220
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ABLAC_08220
Enzymes [BR:abal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     ABLAC_08220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoD PhoD_N Pur_ac_phosph_N Metallophos
Motif
Other DBs
NCBI-ProteinID: AIY36177
Position
861909..863672
Genome map
AA seq 587 aa AA seqDB search
MSEKISRRELIQKSLLGFGALSISVAFTGCNDGSDDESPEIQADFLHGVASGDPLQDKVI
LWTRVTPTDSGVRLKVVWEISTDNQFKQNLKTGMVETSKTDDFTVKVDAAGLQADTVYYY
RFKFGNKVSPVGQTKTLPTSTNKVSFAVCSCSNYPAGYFYVYREMAKQNVDVIIHLGDYI
YEYGADGYATEDATKLGRNLPADNNKEIIKLDDYRKRYALYRQDKDLQAAHQRHPFIVIW
DDHELANDAWREGAENHQSNEGAFSDRKLAALQAYFEWMPIRPVSSTDHLNIYRQFNFGS
LVQLTMLDTRIIARDKQLAYTDYMTATGLDIAKFQGDLTNLVRTLMGYTQRDWLVDKLKQ
STATWNVVGQQVLMSKMWIPAELLASLGQITSGGTSPDALAKMNAQITELVALKLRLQQN
DPTLTAQEKARIMTVAPYNLDAWDGYYAEREFVYDKLAEFNKKIIVLAGDTHNAWASYLY
SQKGKYVGVELATSSVSSPGLEKYLSIPLAQLQQFEFAFTTLIDELVYCNLNQRGYLLVT
LDQAQVHSEWRFVDSIKNAEYQIDSSRQNDIVLDLNLMPLKQGQKTA
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagaaaatttcacgccgagaattaattcaaaaaagtctactcggttttggggct
ttatctatatctgttgcttttacaggttgtaatgatggctcagatgatgaaagcccagaa
atacaagcagattttcttcatggtgtggcaagcggagacccactacaagataaagttatt
ttgtggacacgagtaacaccgacagactctggggtgcgcttaaaagttgtatgggaaatt
tcaaccgataatcagtttaagcaaaatttaaagacgggaatggttgaaacaagcaagact
gatgactttacagtgaaagttgatgcagctgggttacaagcagatacggtgtactactac
cgttttaaatttggtaataaagtttcaccagttgggcagacgaaaacattaccaacatcc
accaataaagtgagctttgcagtatgttcttgttctaactatcctgcgggttacttttat
gtttatcgtgaaatggcaaaacagaatgttgatgtcattattcacttgggtgactatatt
tatgaatatggggcagatggctatgcgacagaagatgcaaccaagttaggccgtaattta
cctgccgataataataaagaaattattaaattagatgattaccgcaaacgttatgcgctt
tatcgtcaagataaagatttgcaagcagctcatcagcgccatccttttattgtgatttgg
gatgaccatgagttggcaaatgatgcttggcgtgagggggcggaaaaccatcaaagtaat
gaaggggccttttcggaccgtaaattagctgccctacaggcctattttgaatggatgcca
attcgtccagtttctagtacagatcatttaaatatttatcgccagtttaactttggctct
cttgttcagttaaccatgctagatacgcgtattattgcgcgtgataagcagcttgcatat
acagactacatgacggctacaggtttggatattgcaaagtttcagggagatttaactaat
ctggtgcgtactttgatggggtatacacaaagagattggttggttgataaattaaagcaa
tctacagcaacatggaatgtagtagggcagcaagttttaatgagtaaaatgtggattcca
gctgagttgttggcgtctttagggcaaattacttcaggaggaacttcgcctgatgcgctt
gctaagatgaatgcacaaattaccgagttggtcgctttaaaacttcgtttacaacaaaat
gatccgacattaacagcccaagaaaaagcaagaattatgacggttgcgccatataatctc
gatgcttgggatggttactatgctgagcgagagtttgtgtacgataaattggcagagttt
aataaaaagatcattgtgttagccggggatacacataatgcatgggcatcttatttatat
agccagaaagggaaatatgttggagttgaattagcgacgagttctgtatcgtctccaggt
ttggaaaaatatttaagtattccactggctcagcttcaacagtttgaatttgcatttact
acattaattgatgaattggtttattgtaatttaaatcaacgaggatacttgttggttact
ctagatcaggcgcaagttcattctgagtggagatttgtagattcaattaaaaatgctgaa
tatcaaatcgattcaagtagacaaaacgatattgtattggatctaaatttgatgccgtta
aaacaaggtcaaaagactgcttga

DBGET integrated database retrieval system