KEGG   Acinetobacter baumannii LAC-4: ABLAC_22680Help
Entry
ABLAC_22680       CDS       T03519                                 

Definition
(GenBank) malonate decarboxylase, alpha subunit
  KO
K13929  malonate decarboxylase alpha subunit [EC:2.3.1.187]
Organism
abal  Acinetobacter baumannii LAC-4
Brite
KEGG Orthology (KO) [BR:abal00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:abal02000]
    ABLAC_22680
Enzymes [BR:abal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.187  acetyl-S-ACP:malonate ACP transferase
     ABLAC_22680
Transporters [BR:abal02000]
 Other transporters
  Primary active transporters [TC:3]
   ABLAC_22680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mal_decarbox_Al
Motif
Other DBs
NCBI-ProteinID: AIY37623
Structure
PDB: 

Position
2380114..2380248
Genome map
AA seq 44 aa AA seqDB search
MVFPEDLGIRRTDATRELLAAKNIADLVTWSDGLYQPPAKFRSW
NT seq 135 nt NT seq  +upstreamnt  +downstreamnt
gtggtattccctgaagatttaggtattcgccgcaccgatgccacacgtgaacttttagcg
gcgaaaaatattgccgacttggtgacatggtcagatggcttatatcaaccacctgcaaaa
ttcaggagttggtaa

DBGET integrated database retrieval system