KEGG   Acinetobacter baumannii LAC-4: ABLAC_25510Help
Entry
ABLAC_25510       CDS       T03519                                 

Definition
(GenBank) threonine dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
abal  Acinetobacter baumannii LAC-4
Pathway
abal00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:abal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ABLAC_25510
Enzymes [BR:abal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     ABLAC_25510
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     ABLAC_25510
    1.1.1.-  
     ABLAC_25510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 Semialdhyde_dh FAD_binding_3 2-Hacid_dh_C TrkA_N
Motif
Other DBs
NCBI-ProteinID: AIY37906
Position
2656438..2657496
Genome map
AA seq 352 aa AA seqDB search
MKAARFYDRGDIRIEDIPEPEVTPGTVGIKVAWCGICGTDLHEFMEGPIFIPPCGHPHPI
SGESAPITMGHEFSGVVYAVGEGVDDIEIGQHVVVEPYIVADDVPTGPGDNYHLSKNMNF
IGLGGRGGGLSEKIAVKRRWVHPISNKIPLDQAALIEPLSVGHHAYVRSGAKAGDIALVG
GAGPIGLLLSAILKAKGLKVIITELSAKRKEKAKESGVADYILDPSEVDVVSEVMKITNG
DGVDVAFECSSVNKVLDTLVAAVKPTGVIVIVSIWSHPASINVHSVVMKELDVRGTIAYV
NDHQETIKLVEEGKINLEPFITQRIQLDDLISQGFETLIHNNESAVKIIVHP
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcgcgtttttatgacagaggcgatatacgtattgaagatatccctgaacca
gaagtcactcccggcactgtaggcattaaggtagcttggtgtggaatctgtggtacagat
ttgcacgaatttatggaagggccaatttttattccaccttgtggacatccgcatcctatt
tcaggtgaatctgcgccgattaccatgggacatgaattttcaggtgtggtttatgccgtt
ggtgaaggtgttgatgatattgaaattggccagcatgtcgtcgtagagccttatattgtg
gcggatgatgtaccgactggaccgggcgataattatcatctttccaaaaatatgaacttt
attggtttaggcggtcgtggcggtggtttatcggagaaaattgcggttaaacgccgttgg
gtgcatccaatttctaataaaattccactggatcaggcagccttaattgaaccgttatcg
gttggtcatcatgcctatgtgcgcagtggtgcaaaggctggtgacattgcactggttggc
ggagccggcccaattggtttattgctttcggcaattttaaaagcgaaagggcttaaggtc
atcattaccgaactaagtgccaaacgtaaagaaaaagccaaagagtcgggtgttgcagat
tatattttagacccgtcagaagttgatgttgtttctgaggtcatgaaaattaccaatggc
gatggtgtcgatgttgcgtttgaatgtagtagcgttaacaaggtgttagatactttggtt
gcggcagtgaaaccaacaggcgttatagttattgtttcgatttggagccatccagcatca
attaatgtgcacagtgttgtaatgaaagagctcgatgtaagaggcacaattgcctacgta
aatgaccatcaagaaaccattaaactggtcgaagaaggtaaaataaatctggaacctttt
attacgcagcgcattcaacttgatgatttgatttcacaaggttttgagaccttaattcat
aataatgagtcagccgttaagattattgtacatccataa

DBGET integrated database retrieval system