KEGG   Acinetobacter baumannii LAC-4: ABLAC_25780Help
Entry
ABLAC_25780       CDS       T03519                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
abal  Acinetobacter baumannii LAC-4
Pathway
abal00071  Fatty acid degradation
abal00072  Synthesis and degradation of ketone bodies
abal00280  Valine, leucine and isoleucine degradation
abal00310  Lysine degradation
abal00362  Benzoate degradation
abal00380  Tryptophan metabolism
abal00620  Pyruvate metabolism
abal00630  Glyoxylate and dicarboxylate metabolism
abal00640  Propanoate metabolism
abal00650  Butanoate metabolism
abal00900  Terpenoid backbone biosynthesis
abal01100  Metabolic pathways
abal01110  Biosynthesis of secondary metabolites
abal01120  Microbial metabolism in diverse environments
abal01130  Biosynthesis of antibiotics
abal01200  Carbon metabolism
abal01212  Fatty acid metabolism
abal02020  Two-component system
Brite
KEGG Orthology (KO) [BR:abal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ABLAC_25780
   00630 Glyoxylate and dicarboxylate metabolism
    ABLAC_25780
   00640 Propanoate metabolism
    ABLAC_25780
   00650 Butanoate metabolism
    ABLAC_25780
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ABLAC_25780
   00072 Synthesis and degradation of ketone bodies
    ABLAC_25780
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ABLAC_25780
   00310 Lysine degradation
    ABLAC_25780
   00380 Tryptophan metabolism
    ABLAC_25780
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ABLAC_25780
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ABLAC_25780
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ABLAC_25780
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:abal04147]
    ABLAC_25780
Enzymes [BR:abal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ABLAC_25780
Exosome [BR:abal04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ABLAC_25780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF5417 PepSY_2
Motif
Other DBs
NCBI-ProteinID: AIY37933
Position
complement(2685697..2686869)
Genome map
AA seq 390 aa AA seqDB search
MSSIVIVSGSRTAMGGFQGSLSSLTAPELGAAVIRESIQRAGVKPEQVDEVIFGCVLSAG
IGQGPARQAMRKAGVPDHVGAVTINKLCGSAMKAVLMASDTLKAGSANIIVAGGMESMTN
APYILPKARGGYRMGHGEIKDHMFLDGLEDAETGRLMGSFAQDMANTKGFTREQMDDFAI
SSLKKAQTAITEGYFKEEIVPVEVKTRKGVEVIDQDEQPLKANLEKIPTLRPAFSKDGTI
TAANSSSISDGAAALVLTTEEYAQSHGLNTLAKIVATSTHSQHPSEFTIAPISAIQKVLE
RAGWSVDEVDAWEINEAFAMVAMAPIHELGIDEAKVNVHGGACALGHPIGATGSRIILSL
IYALKRLGKKKGVAALCIGGGEATAVAIEI
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgagttcaattgttatagtttcaggtagccgtactgcaatgggtggttttcagggtagt
ttatcttctctaactgctccagaacttggcgctgctgtcatccgtgaatcgatccaacgt
gcaggtgttaaacctgaacaagtagatgaagtgattttcggttgcgtactcagtgcaggt
attggtcaaggccctgctcgtcaagccatgcgtaaagctggcgtgcctgatcatgtcgga
gctgtgaccattaataaactttgcggctctgcaatgaaagcggtcttaatggcatcagat
accttaaaagcaggcagtgccaatattattgtggctggcggcatggaatctatgacgaat
gcaccttatattttgcctaaagctcgcggtggttatcgtatgggacacggcgaaattaag
gaccatatgtttttagatggcctcgaagatgcagaaactggtcgtttaatgggttctttt
gctcaagacatggcaaataccaaaggctttacccgtgagcaaatggatgattttgcaatt
tcttcacttaaaaaagcgcaaactgcgattacggaaggttatttcaaagaagagattgtt
cctgttgaagtaaaaacccgtaaaggtgttgaagttattgatcaagatgagcaaccatta
aaagcaaatcttgagaaaattccaactttacgccctgcttttagcaaggacggtacaatt
acagccgctaactcaagctcgatttctgatggtgctgctgcattagtacttaccactgaa
gaatatgctcaaagtcacgggttaaatactttagcaaaaattgtggcaacttcgactcac
tctcagcatccaagcgaatttactattgctccaattagtgcaattcagaaagtacttgag
cgtgctggttggtctgttgatgaagtagatgcttgggaaattaatgaggcttttgcgatg
gtggcaatggcaccaattcatgagctaggaattgatgaagcaaaagtaaacgtccatggt
ggtgcatgtgcattaggccatccaattggtgctacaggttcaagaattatcctttctctt
atttatgcattaaaacgcttaggtaaaaagaaaggtgtcgctgccctatgtattggtggt
ggtgaagcaacagccgttgcgattgaaatttaa

DBGET integrated database retrieval system