KEGG   Candidatus Nanopelagicus limnes: B1s21122_02075Help
Entry
B1s21122_02075    CDS       T05073                                 

Definition
(GenBank) putative phosphoglycerate mutase
  KO
K22306  glucosyl-3-phosphoglycerate phosphatase [EC:3.1.3.85]
Organism
abam  Candidatus Nanopelagicus limnes
Brite
KEGG Orthology (KO) [BR:abam00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    B1s21122_02075
Enzymes [BR:abam01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.85  glucosyl-3-phosphoglycerate phosphatase
     B1s21122_02075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ASY09140
UniProt: A0A249JX92
Position
complement(876764..877426)
Genome map
AA seq 220 aa AA seqDB search
MSNPNSLIRVVLWRHGQTDWNVENRFQGHSDIPLNKVGEYQVVQAASVLAGLKPNRIISS
DLIRAQSTAAALADLTNLKVEINPGLRETHGGLWEGKTAPENRATHGDLFANWYEGGDEP
AGVTGERRSDVAKRAVSVIEKETENFSGTIVFVTHGGTVRSVLGSILKLPIAQWGVIGGL
SNACWSVLELTKHHTGSRWYLAEHNAGSLPEPVFGDDAVN
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatccaaattcattaattcgcgtcgtactttggcgccatggccaaactgattgg
aatgttgaaaatcgttttcaaggtcactcagatatcccattaaataaagtgggggagtat
caagtagtccaagctgcctctgttttagcagggttgaaaccaaatcgaataatttcaagt
gatttaattcgtgcgcaatcaacagctgcggcgttagctgatttaacaaatttaaaggtt
gagattaatccagggctgcgggaaactcatggtggactttgggaaggtaaaactgcgcca
gaaaatagggcgacacatggtgatttatttgctaattggtatgaaggtggtgatgaacca
gcaggtgttactggtgaaagacgaagtgatgttgcaaagcgcgcagttagtgttattgaa
aaagagactgaaaacttttctggaactattgtttttgtaacccatggtggaactgttcga
agtgttttaggttcaattcttaaacttccaattgcgcaatggggagtaattggtggctta
tcaaatgcatgctggtcggtattggaattaactaaacatcacactggatcacgttggtat
ttagcagagcacaatgccggctcattacctgagcctgtctttggagatgatgcggttaat
tag

DBGET integrated database retrieval system