KEGG   Candidatus Nanopelagicus limnes: B1s21122_03925Help
Entry
B1s21122_03925    CDS       T05073                                 

Gene name
metF
Definition
(GenBank) methylenetetrahydrofolate reductase (NADPH)
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
abam  Candidatus Nanopelagicus limnes
Pathway
abam00670  One carbon pool by folate
abam01100  Metabolic pathways
abam01120  Microbial metabolism in diverse environments
abam01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:abam00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    B1s21122_03925 (metF)
Enzymes [BR:abam01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     B1s21122_03925 (metF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: ASY09483
UniProt: A0A249JY69
Position
499273..500136
Genome map
AA seq 287 aa AA seqDB search
MSNDQRATSFSLEFFPPKDLAGEERLWQVLAQLQPLKPDFVSVTYGAGGSTRDRTIRVTT
EITDRTQIPTVAHLTCVGSTRSELVEVLNQYKKSGIKSILALRGDPQGGPTSEWQSIPTG
LDHADELVELAMQIGGFNIGVAAFPDGHPASDFNLEKDVDVLLRKEQLGATFATTQFFFE
FDKWQSIVDRLAKRGSNLPIIAGILPITNLKQLNRMVELSGVTIPAHISKRFENAGDDLS
EIKKIGIDIATELGSKLLAAKVPGIHFYTMNTAESTIVIAKNLGLVK
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaatgatcagagagccacttccttctcgttggagttcttcccaccaaaggatctg
gcaggagaagaacggctctggcaggtattggcacaacttcaacccttaaagccagacttc
gtatcagttacctatggcgctggtggatccacgcgagatagaacaattcgtgttaccact
gaaattactgatcgcacccaaatcccaacggttgctcatttaacctgtgttggctcaact
agatctgaattagttgaagttttaaatcaatacaaaaaatctgggattaaaagtatttta
gcgttaaggggagatccacaaggaggaccaacatctgaatggcaatcaatccctaccgga
ttagatcatgcagatgaactcgtcgagttagctatgcaaataggtggatttaacattgga
gttgctgcatttccagatgggcacccagcatcagattttaacttggaaaaagatgtcgat
gtgcttttgcgaaaagaacagctaggtgcgacctttgcgacaacacaattcttctttgaa
tttgataaatggcaaagcattgtagatcgattagcaaagcgtggatctaatcttccaatc
atcgctggcatacttcctattacaaatttaaaacaattgaaccgaatggtcgaattaagt
ggagtgacgattccagctcatatttcgaaaagatttgagaatgcgggggatgatctaagt
gagatcaagaaaataggtattgatattgcaactgagcttggtagtaaattactagcagca
aaagttccaggaattcatttttatacaatgaacactgctgaatcaacaattgtaattgca
aaaaatttaggtttggttaaataa

DBGET integrated database retrieval system