KEGG   Candidatus Nanopelagicus limnes: B1s21122_04315Help
Entry
B1s21122_04315    CDS       T05073                                 

Gene name
pgsA
Definition
(GenBank) CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase
  KO
K00995  CDP-diacylglycerol---glycerol-3-phosphate 3-phosphatidyltransferase [EC:2.7.8.5]
Organism
abam  Candidatus Nanopelagicus limnes
Pathway
abam00564  Glycerophospholipid metabolism
abam01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abam00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    B1s21122_04315 (pgsA)
Enzymes [BR:abam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.5  CDP-diacylglycerol---glycerol-3-phosphate 1-phosphatidyltransferase
     B1s21122_04315 (pgsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CDP-OH_P_transf
Motif
Other DBs
NCBI-ProteinID: ASY09552
UniProt: A0A249JYG9
Position
429329..429871
Genome map
AA seq 180 aa AA seqDB search
MKKVGRPNLPNSLTIFRIIALPFCAYALFKNGGDDENWRIIAFTLFFIVGLSDILDGKIA
RDRNQITEFGKLLDPIADKAMLATATIGASLLGYLSWWVTAIFLVREVAVTILRFAVIKK
GVIPASKGGKLKTFFQNFGVGFYILPLPTVLTLPRDIFMAIAIYLTISTGVDYFRKALKK
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagttggacgtccgaacttgccaaattcacttacaatttttcgaatcatagct
ttgcccttttgcgcatacgccctatttaaaaatggcggcgatgatgagaattggcgaatt
atcgccttcaccttgtttttcatcgtgggcttaagtgatattttagatggcaagattgcc
cgagatcgaaatcaaattactgaatttggaaaattactagatccaattgctgataaagca
atgttggcaactgccacgattggtgcctcacttcttggctatttgtcttggtgggtgacg
gcaatatttttagtccgagaggttgctgtaacaatcttgcgttttgcggtgattaaaaaa
ggtgtgattccagcaagtaagggtggcaaactcaagacttttttccaaaactttggagtg
ggattttatatattgccactgccgacagttttaaccctaccccgagatattttcatggca
attgctatttacttaacaatttcaactggcgtggattactttagaaaggcattaaagaag
tga

DBGET integrated database retrieval system