KEGG   Candidatus Nanopelagicus limnes: B1s21122_04390Help
Entry
B1s21122_04390    CDS       T05073                                 

Definition
(GenBank) tRNA pseudouridine55 synthase
  KO
K03177  tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
abam  Candidatus Nanopelagicus limnes
Brite
KEGG Orthology (KO) [BR:abam00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:abam03016]
    B1s21122_04390
Enzymes [BR:abam01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     B1s21122_04390
Transfer RNA biogenesis [BR:abam03016]
 Eukaryotic Type
  tRNA modification factors
   Psudouridine synthases
    B1s21122_04390
 Prokaryotic Type
    B1s21122_04390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TruB_N TruB_C_2 TruB_C
Motif
Other DBs
NCBI-ProteinID: ASY09567
UniProt: A0A249JYG1
Position
413473..414348
Genome map
AA seq 291 aa AA seqDB search
MDGFLLVDKAGAMTSHDVVAMARKKLDTKKVGHAGTLDPMATGVLVLGVGIATRLLTYIT
DGKKAYEATINLGSATHTDDKDGDVISTATAAQIAKVNDEVITNEIAKFVGTIKQRPSSV
SAIKIDGKSAHARVRAGESVDIPERDVTIDEIVVKEIRHTATAIEVDVSVTCSAGTYIRA
IARDLGERLSIGGHLTSLRRTLVSPFTLQDCQSLANAPLISITSVIEKLFPIRKLDLSQS
REITFGRVIEQNQQSGIVAALDSQDNFLALLENKLQGSQVMAAPILVKVSE
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggatggctttttattagtagataaagccggggcaatgactagccatgatgtagtggcg
atggctcgtaaaaaacttgatactaaaaaagtcggccatgctggcacattagatccgatg
gcaactggggtgttagttcttggtgttggcattgctaccaggcttcttacttacataaca
gatggtaaaaaagcatatgaagcaactattaatttgggaagtgcaacacatactgatgat
aaagatggggatgtaatctcaaccgccactgctgctcagatagcaaaagttaatgatgaa
gtaattacaaatgagatagcaaagtttgttggaactattaagcaaagacctagttcagta
tctgccataaaaattgatggaaaatctgctcatgccagagttagggcaggggagagtgtt
gatattcctgagcgagatgtgactatcgatgagatagtggttaaagagattagacataca
gccacagcaatcgaagttgatgtatctgttacctgctctgccggaacttatattcgagcg
attgccagagatttaggtgaaagattaagtattggcggccacttaacctcacttcgtcgt
actttagtttcaccatttactttgcaagattgtcaatccttggctaacgcgccattgatc
tctatcacttcagtaattgaaaaactatttccgatcagaaaattggatttatcccaaagc
agagagatcacatttggccgagtgattgaacaaaaccaacaaagtgggattgtggcagcc
ctggattcacaagataatttcctggctttactagagaacaagttacaaggttcacaagtt
atggctgctccaatattagttaaggtcagtgagtaa

DBGET integrated database retrieval system