KEGG   Anaerolineaceae bacterium oral taxon 439: BEQ56_00265
Entry
BEQ56_00265       CDS       T04463                                 

Definition
(GenBank) xanthine dehydrogenase molybdenum-binding subunit XdhA
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
abao  Anaerolineaceae bacterium oral taxon 439
Pathway
abao00230  Purine metabolism
abao01100  Metabolic pathways
abao01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:abao00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BEQ56_00265
Enzymes [BR:abao01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     BEQ56_00265
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C PaREP1
Other DBs
NCBI-ProteinID: AOH42056
UniProt: A0A1B3WM91
Position
complement(57597..59936)
AA seq 779 aa
MGIKRNVVRLDAVQKATGEAKYVEDLIPVGALHGKMVRSTIANGMVKSIDTSEALKMPGV
ELILTCFDVPKNLFATSGHPLSLDPNHTDTKDKLILEQRVRYYGDDIAVVVADTPLNARL
AAEKVKVTYEVFEPLLTPAAAIHHPCTIHEFRPGNELSRMDFNISPEGEVNFYTGKFSTE
KEIAGREDLVGVQYYVPMVNACHIEPNGCFAYMEGRKLIICSCNQVPFTLRRNVAEAVGI
PVGDIRVIRPYIGGGFGNKQDTMYEPIVALCTMKLGGRPVAIILTREETFTSTRVRHAFD
MLIKSEVDAAGKMIKRGLRINSNGGAYAAHTHAVTAYAITNNFQNYPTSGVQVGESSTAY
TNLPSAAALRGYGIPQLAFAMESEMDDIALAHGWDPVDLRLKNIQTDGFVDPFDKFVVSS
CGMQGCIQRGREVSGWDRKRKEYSEFNKTSKNIKKGIGMACFSYKTGVWPIQVENASCRI
VMNEDGTAVIQVGATEIGQGSDTVFCQMVSEITTIPENRLTLIPYCDTDVSPYDSGAYAS
RQTYVSGGAVRKAAELLRGKLLARAAAVYDQAYESLCLESEKIKNIETGQIICTIGQLCT
FMNHTNDHVTMTEHLTAEATYTAQSICFSYGVSYIDLDVDVPLGKVKINKVYSVHDSGQI
LNPALSHGQLHGGIAMGLGYALGEQLLFDPKTGRPLNNNLLDYKTPTAMDMPEIETYFVE
TFEPSGPFGNKGLAEPPLIPQAPAVRNAILHATGIGVFNLPMNPQSLVHAFIEAGLIQN
NT seq 2340 nt   +upstreamnt  +downstreamnt
ttgggtattaaaagaaatgtcgttcgcctggacgctgtccagaaagcgaccggggaagca
aaatatgttgaggatctgatccctgtcggtgcgcttcacggcaagatggttcgcagtacg
atcgcgaatgggatggtaaagtcgatcgatacttctgaagcgttgaaaatgccgggcgtt
gaattaattttgacgtgtttcgacgtcccgaaaaatttattcgcgacttcggggcatccg
ctttctctggatccgaaccacactgatacgaaggataagcttattcttgaacagcgcgtc
agatattatggagacgatatcgcggttgtcgtcgcggatacgccgttgaacgcaagactt
gcggctgaaaaagttaaagtaacgtacgaggtatttgagcctttgctgacgccggctgcg
gcgattcatcacccctgtacaattcatgaattcagacctgggaacgaattgtctcgaatg
gatttcaatatttcgccggaaggagaagtaaatttctatacagggaagttttcgacggag
aaggaaattgccgggcgggaggatctggttggcgttcagtattatgtcccgatggtgaac
gcctgtcatattgagccgaacggttgcttcgcttatatggaagggcggaagttgattatc
tgttcctgcaaccaggttccttttacgctgcggcgaaatgtggcggaagctgttgggatt
ccggtcggcgatatccgcgtcatccgaccttatatcggcggcggttttggaaataaacag
gacaccatgtacgagccgatcgttgctttatgtacaatgaaattgggcggacgtccggtc
gcgatcattcttacgagagaagaaacttttacttctacccgcgttcggcatgcttttgat
atgctgattaaatccgaggtcgacgcagcgggaaaaatgatcaagcgcggtttgcggatc
aattcaaatggaggggcgtatgcggcgcatacgcatgcggttaccgcttacgcaataacg
aacaatttccaaaattacccgacctcgggcgttcaggttggggagtcgtcgacggcatac
acgaatctgccttcggccgcggcgctcaggggttacggtattccgcagctggcttttgcg
atggagtccgaaatggacgatatcgcgcttgcgcacggatgggatccggttgacctgagg
ctgaaaaatattcaaaccgacggatttgttgacccgtttgataaatttgttgtgtccagt
tgtggaatgcagggctgtattcagaggggccgcgaagtttccggctgggatcgtaagcgg
aaagaatattccgaatttaataagacgtcgaagaatatcaaaaagggtatcggaatggcc
tgcttctcatataagaccggcgtctggccaattcaagttgagaacgcgtcctgccgaatt
gtgatgaatgaggatggaaccgctgtgattcaagttggggcaactgagatcgggcaaggt
tcagacacggttttttgccagatggtttccgagattacgacgattccagaaaatcgcctg
acgttaattccatactgcgatacggacgtatctccgtatgacagcggcgcgtatgcctcc
cgccagacttatgtgtctggcggcgctgtcagaaaagcggcggaactcttgcgtggaaag
cttctggcgcgcgccgcggcggtatatgatcaggcttatgagtccctctgtctcgagagc
gagaagattaagaatattgagaccgggcaaattatttgcactattggacagctttgtacg
ttcatgaatcataccaacgatcatgtgacaatgacggagcatcttaccgccgaagcgacc
tacaccgcgcagtcgatctgtttttcctatggcgtcagctatatcgatcttgatgtcgac
gttcctttgggaaaggtcaaaattaacaaagtctactcggttcatgatagcgggcagatt
ttgaatcctgcgctttctcatggtcagctccatggcggtatcgcgatggggcttgggtat
gcgcttggcgagcagctgctttttgatccgaagacagggcgccccttgaataataatttg
cttgattataagacgccaacggctatggatatgcctgagattgagacttatttcgtcgag
acgtttgagccgtcagggcccttcggaaataaagggctggccgaaccgccgcttattccg
caggcgcccgccgtccgaaacgcaatcctccacgctacagggatcggcgtttttaacctg
ccgatgaatccgcaaagccttgtccatgcgtttattgaagctggcctgatccagaactga

DBGET integrated database retrieval system