KEGG   Anaerolineaceae bacterium oral taxon 439: BEQ56_01005Help
Entry
BEQ56_01005       CDS       T04463                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
abao  Anaerolineaceae bacterium oral taxon 439
Pathway
abao00471  D-Glutamine and D-glutamate metabolism
abao01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abao00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BEQ56_01005
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:abao01011]
    BEQ56_01005
Enzymes [BR:abao01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     BEQ56_01005
Peptidoglycan biosynthesis and degradation proteins [BR:abao01011]
 Precursor biosynthesis
  Racemase
   BEQ56_01005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: AOH44340
UniProt: A0A1B3WTQ6
Position
204122..205015
Genome map
AA seq 297 aa AA seqDB search
MRTETGPENEPAARAIGVFDSGVGGLTVMRALMKTMPMEDIVYFGDTARVPYGSKSKETI
VRFSRQIVSFLRSRSVKAIVVACNTASAWALEELRGEFELPIVGVIAPGAAAAVSATRNG
KIGVIGTYATVESQAYDRAIRALDPALTPIKTACPLFVPLVEEGLTSGEITDRVVAYYLS
GMKAGGVDTLLLGCTHYPLMKGAIAAFMGEGVRCIDPAKNTAEELRGILESAGLLRGGAD
VPAKAEYTFAVSDAEERMTAFANRILPFSIAAAEKIAIESYEPIPHGSFNEERGTLR
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgagaaccgaaaccggccctgaaaacgaacccgccgcccgcgcgatcggcgtctttgac
tccggcgtcggcggactgaccgtcatgcgcgcgctgatgaaaacgatgccaatggaggat
atcgtttacttcggcgacaccgcgcgcgttccctacgggagcaagtcgaaagaaacgatc
gtccgcttctcgcgccagatcgtcagcttcctgcgcagccggtccgtcaaagccatcgtc
gtcgcctgcaacacggccagcgcctgggcgctcgaagagctccgcggcgaattcgagctt
ccgatcgtcggcgtcatcgccccaggcgcggccgcggcggtttcggcgacgcggaacggg
aaaatcggcgtcatcggcacatacgcgaccgtcgagagccaggcctacgaccgcgcgatc
cgcgcgctcgatccggcgctgacgccgattaaaaccgcctgcccgctgttcgttccgctc
gttgaggaagggctgacctccggcgagattaccgaccgcgtcgtcgcctattatttaagc
gggatgaaagccggcggcgtcgatacgctcctcctcggctgtacgcattatccgctgatg
aaaggcgcgatcgccgcgttcatgggcgagggcgtccgctgtatcgatccggcgaagaac
acggccgaagagctgcgcgggatactggaaagcgcggggctcctccgcggcggcgcggac
gtcccggcgaaagcggaatacaccttcgccgtcagcgacgccgaagaaaggatgaccgcg
ttcgcgaaccggatcctgccgttttcgatcgcggccgcggaaaaaatcgcgatcgaaagc
tatgagcccatcccgcatggatcattcaacgaagaaaggggaaccctgcgatga

DBGET integrated database retrieval system