KEGG   Acidobacteriaceae bacterium SBC82: ACPOL_5624Help
Entry
ACPOL_5624        CDS       T05576                                 

Definition
(GenBank) Arylesterase precursor
  KO
K10804  acyl-CoA thioesterase I [EC:3.1.2.- 3.1.2.2 3.1.1.2 3.1.1.5]
Organism
abas  Acidobacteriaceae bacterium SBC82
Brite
KEGG Orthology (KO) [BR:abas00001]
 09100 Metabolism
  09103 Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    ACPOL_5624
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:abas01004]
    ACPOL_5624
Enzymes [BR:abas01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.2  arylesterase
     ACPOL_5624
    3.1.1.5  lysophospholipase
     ACPOL_5624
   3.1.2  Thioester hydrolases
    3.1.2.2  palmitoyl-CoA hydrolase
     ACPOL_5624
    3.1.2.-  
     ACPOL_5624
Lipid biosynthesis proteins [BR:abas01004]
 Fatty acid synthase
  Component type
   ACPOL_5624
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lipase_GDSL_2 Lipase_GDSL OSK Lipase_GDSL_3
Motif
Other DBs
NCBI-ProteinID: AXC14872
UniProt: A0A2Z5G6K4
Position
complement(5983607..5984326)
Genome map
AA seq 239 aa AA seqDB search
MTLRSLSTPSRFSLLSILLVFALVLASCSSTKPKSAEDEPDTSSPPADSRIIDPRDSRPV
IVAFGDSLTAGYGAAPGESYPDYLQRELDRSGYHYRVANLGVSGNTTKDGVDRLKDVLAL
KPKVVIVAFGGNDGLRGLPIEATRNNLDQIVSTLTTSNVKVVLGGITLPPNYGPDYIRQF
NDTYALLARKFHAPLLPFLLIKVYGTPGGMQEDGIHATAQGNEQVAKNLLPLITPLLKK
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
gtgaccttgcgctcgctctcgactccaagccggttctcactgctttcgattctgctcgtc
ttcgctcttgttctggccagttgcagctccaccaagccgaagagcgctgaggacgaaccc
gacacatccagtccgcctgccgacagcaggatcattgacccccgggatagccgcccggta
atcgtcgcatttggcgatagcctgaccgctggctacggcgctgctcccggcgaaagctat
cccgactacctccagcgcgagctcgatcgcagcggctaccactatagagtcgccaacctt
ggggtaagcggcaacactactaaagacggcgttgaccgcctcaaagacgttctcgccctt
aagccgaaggtggtgatcgtcgcgtttggcggcaatgacggcctgcgcggcctcccgatc
gaggccacccgcaacaacctcgaccagatcgtctccactctcactacctcgaacgtcaaa
gtcgtgctcggtggcattactctcccgccaaattacggtcccgactacattcgccagttc
aatgacacttacgcactgctcgcgcgtaagttccatgcgccgctcttgccttttctcctg
atcaaagtctacggcacacctggcggcatgcaggaggatgggatccatgccacagcgcag
ggcaacgaacaagtcgccaaaaacctcttgccgctgatcacaccactgctcaagaagtga

DBGET integrated database retrieval system